SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427739787|ref|YP_007059331.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427739787|ref|YP_007059331.1|
Domain Number 1 Region: 173-471
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.77e-83
Family NadC C-terminal domain-like 0.0000424
Further Details:      
 
Domain Number 2 Region: 39-172
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.97e-40
Family NadC N-terminal domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427739787|ref|YP_007059331.1|
Sequence length 475
Comment putative nicotinate phosphoribosyltransferase [Rivularia sp. PCC 7116]
Sequence
MVKTTINTNRYCQGVEKMTSLLNYDMPLSEQLNVSSADYSLLTDLYQLTMAACYKGENID
QKRASFELFARKLPEGFNYLIAMGLSQALEYLEKFSFNQTQIEALQETGIFASAPQQFWS
LLAEGKFTGDVWAIPEGTAVFALEPLLRIEAPLWQAQLVETYLLNCLNYQTLIATRAARS
RDVAGEKTTLLEFGTRRAFSPQASLWAARAALAGGLDATSNVLAALQLGEKPSGTMAHAL
VMALCALEGSEEKAFSAFHQYFPGAPLLIDTYDTIAAARKLAAKVKAGEINLTGIRLDSG
DLVALSKQVKEILPDTLIFASGDIDEWEIARLKQNNAQIDGYGIGTRLVTGKPVNGVYKL
VEIEGIPVMKKSSGKVSYPGRKQIFREFVNGELKADTLGLVSENYPNRQPLLKLFMKDGK
RLEPQETIKTIRNRTTASVVSLPAQVRNLDSLSSMSVDISSSLQELINQTNRDSN
Download sequence
Identical sequences K9RNB5
gi|427739787|ref|YP_007059331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]