SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427740037|ref|YP_007059581.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427740037|ref|YP_007059581.1|
Domain Number 1 Region: 7-428
Classification Level Classification E-value
Superfamily Clc chloride channel 1.31e-102
Family Clc chloride channel 0.00000169
Further Details:      
 
Domain Number 2 Region: 440-561
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-31
Family CBS-domain pair 0.00072
Further Details:      
 
Domain Number 3 Region: 592-723
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000000117
Family Universal stress protein-like 0.015
Further Details:      
 
Domain Number 4 Region: 732-859
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000000117
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427740037|ref|YP_007059581.1|
Sequence length 865
Comment chloride channel protein EriC [Rivularia sp. PCC 7116]
Sequence
MFLTKYFRDFWQPRKGLAIAEACVIGVVAALSAIFLRFSSGSLGTFRVNTSYAIPALFAL
PLIGASFGFTAGFLVDRFAPEASGSGVPQVKASLANVPIRLSWRVAIVKLIGAILTLGSG
MTLGRQGPTVHVGAALAAGMSRVFPTSPDHRRQMIAAGAGAGLAAAFNAPITGILFVVEE
LLQDLSGITLGTAIIASFIGGVLSRLLGGRSLQLNLELIESQTTFAITELPFYLILGLLA
GLLAALFRHGLIQSLKFYRKLRISLPLKLALAGLVSGILIAMLPELFRNNTGLREFILAG
KPSVYRVALVFVAQFILTLIAFGSGAPGGLFAPSLILGSCLGYLIGVIEFRFLGISSPDT
YALVGMGAFFSGVSKVPITAIMIIFEITTDFNLVLPLMIGSVTSYLVADKLIPGSLYAKL
LELNGIDIDTENSIDGRITQLTAQEVMQRQVETLQAQMTVDEAIQAFSHSTQRGFPVLEN
SKLVGIVTQSDLMKIREGKLSRNAPVKEIMTSQPLTITPEHNLSNVLYLLNRHQISRLPV
LEGRRFVGIISRGDIIRAEANYLNCESFPNQPKIKPSYKVYQTQSPSVGRGRLLVLIANP
ETAHKLLQMAAMIAKHNRYEVECLQVITISRHNKPAETPVKTAPSRKLLLSAEVIGKRWK
IPVHTQIRVAHEVANATLETVKERHIDTLLMGWKGSTHTPGRIFGNVVDTIIRQATCELL
LVKLGNSSNPINFKRCLVPMAGGPNSKIALKLLPALATYTQKLEIRLTQVFSSEAQIDVK
VLQAAKRLLIDRYKLSNKINAVHIKAHSVPEGIINLVKTGNFDVVVLGASGEGMLQQAIN
GNIPEAIASGVDCTVILVRSMSSEE
Download sequence
Identical sequences K9RP22
gi|427740037|ref|YP_007059581.1| WP_015122583.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]