SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427740083|ref|YP_007059627.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427740083|ref|YP_007059627.1|
Domain Number 1 Region: 100-320
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.73e-47
Family BC ATP-binding domain-like 0.00088
Further Details:      
 
Domain Number 2 Region: 2-96
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.45e-23
Family BC N-terminal domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 326-384
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000251
Family BC C-terminal domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427740083|ref|YP_007059627.1|
Sequence length 399
Comment 5-(carboxyamino)imidazole ribonucleotide synthase [Rivularia sp. PCC 7116]
Sequence
MKRIGVIGGGQLALMMGTAAQKLGVELIVQTPKANDPAVSIAKDTIFAAVDDAIATAELA
RKCDVITFENEFVDLEALSKLATEKVCFRPRIEALSPLLDKYHQRCFLQNLNIPVPKFEL
PESLFAISSSSTGQDTKVNKLNESELSFPVVLKARRHGYDGQGTFIIKDLISLKQKLCLD
NPEENQTNNLIESHFLLEEFIPFQKELAVIAARSASGEVSTFVVVETQQEQQVCRRVIAP
ADISLQTENTIKDIAATILDNLQVIGVFGIELFLTNNGEVLVNEIAPRTHNSGHFSIDAC
FTSQFEQQLRVLCDLPLGNTAMKNPCAIMVNLLGYETQKSSYIDKRFALAKIPGAHVHWY
GKSESRPGRKLGHITVLLDKLNRDEAMTIAKNIESIWYS
Download sequence
Identical sequences K9RMB1
gi|427740083|ref|YP_007059627.1| WP_015122629.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]