SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427740151|ref|YP_007059695.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427740151|ref|YP_007059695.1|
Domain Number 1 Region: 92-427
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 4.53e-91
Family MLTA-like 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427740151|ref|YP_007059695.1|
Sequence length 430
Comment membrane-bound lytic murein transglycosylase [Rivularia sp. PCC 7116]
Sequence
MRIKKSFSIITIALPVAAVLVTISPLGRLLLKPVECQLKRWQLPASVNTSKPDVSTKKPR
ALVLVATSKPPFPCCEGDTSCLDKQIWGENGQQSDRKILFNSIDNSLRYLQTDSAKKRYD
KYQVPGISRERIINSLQRFRQLLLETKSAAELNKAVAEEFVFYQSVGNDNKGKVLFTAYF
EPLYIASRQQTAEYRYPIYALPPDLKDWQRPHPTRLDLEGADGLQGSQGKLKGLELFWFK
SRLEPYMMQIQGSAKLRLLDGTQTTVGFAGNVAHNYRSIGKALIDDGELPSSGVTMPTIL
EYFEKDPKKLDVYIPRDPSFVFFQENKGAPAQGSIQVGLSAERSIATDKALMPPGALALI
RGHFPFATDNGEMKHRTVSRYVLDQDAGGAIKGAGRVDYFLGTGKIAGDRAGVTVTNGQL
YYLLLKNKSS
Download sequence
Identical sequences K9RNU9
gi|427740151|ref|YP_007059695.1| WP_015122697.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]