SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427740185|ref|YP_007059729.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427740185|ref|YP_007059729.1|
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.94e-33
Family Canonical RBD 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427740185|ref|YP_007059729.1|
Sequence length 95
Comment RRM domain-containing RNA-binding protein [Rivularia sp. PCC 7116]
Sequence
MSIYVGNLSYDVTQEDLSKVFAEYGSVKRVQLPTDRETGRSRGFGFVEMQSEDEESSAIQ
ALDGAEWMGRAMKVNKARPREERGNRRSGGGGNWG
Download sequence
Identical sequences K9RQ02
WP_015122731.1.44015 gi|427740185|ref|YP_007059729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]