SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735549|ref|YP_007055093.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735549|ref|YP_007055093.1|
Domain Number 1 Region: 1-256,318-354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.25e-27
Family ABC transporter ATPase domain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 451-549
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 6.41e-25
Family Rad50 coiled-coil Zn hook 0.0031
Further Details:      
 
Domain Number 3 Region: 1-52,787-993
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.89e-24
Family ABC transporter ATPase domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735549|ref|YP_007055093.1|
Sequence length 1008
Comment exonuclease SbcC [Rivularia sp. PCC 7116]
Sequence
MIPVQVTLKNFLSYQDASLDFSGLHTACICGSNGAGKSSLLEAITWVVWGESRAASEDDI
IHTGAKDVRVDFTFEANGEIYRVIRTRRRGSSSALEFQIETQEGFKSLTSKGLRATQEVI
LSHIKLDYDTFINSAYLRQGRADEFMLKRPSERKEILAELLKLNQYDELEDKAKELSRQL
KARGEELERTLGSIKTQLQQQETIAQQKTELETELNELQKLQGFDNIQLQNLQVIQHQRQ
GWEEQLHFVRQQYNNLTQDSKRLESEQSSLKAQLDSLKGLLNREAEIKAGYAHYQTLQSE
EESMGALFAQYTRASQLRQQKLSQLSKHIQGIERQLQQSQAQLEALQQQEKDIERTLKHT
GDVETALEKLKAARGHLSHLDNLQMQVSPLLQQRSLLQTELHRTQAGIVARVEQLETTHR
QLQNQSRRQPQIQQAVMEVETKIEQLDKDKVYLQRLQEKGLEKRSFMERLHAQQREYERL
LGELEQKLQMLQNPDAICPLCERPLDEHHWNRVVDKTEVEYNDTQGQLWVFREQLAVSER
EIQLFRQEYRSVNSKLSPYESLREQKGELAAQLQATSEVDQQIQQITDEKERLEVTLRLG
DYAPQKQKELQELEEYLQQLDYNEQNHALARSEVEKWRWAEIKQGQIKDARKRQAQLAAR
KPEIQTTINQLEHQIELEQVDSEIARAIKELENQITHMGYDNERHNQIRIDVRQAQSWHL
LHQQLVSALSQYPEIKKRSQHVEEALKARLSEKQQLATNINGIIAQLEQTTNPTAQIQDL
EQKLANRRRQLDDKLGHLGRLQQQSQYLENLQIQHTEKQQQLKTVRSQQRVYQELAQAFG
KNGIQALMIENVLPQLEAETNQLLSRLSANQLHVQFVTQRAGKTSKAKKKNAKLIDTLDI
LIADARGTRAYETYSGGEAFRINFAIRLALAKLLAQRAGAALQLLIVDEGFGTQDNEGCD
RLIAAINAIAPDFACILTVTHMPHLKEAFAARIEVNKTQDGSKIRMMI
Download sequence
Identical sequences K9RAT3
gi|427735549|ref|YP_007055093.1| WP_015118121.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]