SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427735796|ref|YP_007055340.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735796|ref|YP_007055340.1|
Domain Number 1 Region: 4-321
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.49e-93
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000476
Further Details:      
 
Domain Number 2 Region: 352-484
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 6.8e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735796|ref|YP_007055340.1|
Sequence length 487
Comment cysteinyl-tRNA synthetase [Rivularia sp. PCC 7116]
Sequence
MTLTIYNTLTRRKETFQPLEPGKLKMYCCGVTVYDYCHLGHARSYIVWDTVRRYLKFSGY
QVRYLQNFTDIDDKILNRANAENTSMEEVSQKYIQAYFEDIRRLNVIDASEYPRVTENIT
PIHQLIAELERKDYAYAVNGDVYYKTENFAEYGKLSGKQLEDMQAGASGRVDLEDLSGKK
KHKPSDFALWKAAKPGEPAWESPWGMGRPGWHIECSAMIRANLGETIDIHGGGGDLVFPH
HENEIAQSEVVTGKPLANYWMHNGMVTVNGVKMSKSLGNFTTIRELLDRPIDPMVIRLFV
LQGHYRKPLDFTKDAISSAQNAWETLKNGLLFRHQYGEKLGWKETNLNPETELQNSQINS
FQTAMDDDFNTPGGLAVLFELAKELRRNANIITHQGNTEIPSEKLKQMWQTLVTLAKVFG
LEILSPAENKNASEVLSNAEILALIEQRQDARQNRNFALSDSIRNQLQAVGVNLIDQPNG
ETRWHRN
Download sequence
Identical sequences K9RBD0
WP_015118368.1.44015 gi|427735796|ref|YP_007055340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]