SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ABX80696 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX80696
Domain Number 1 Region: 32-358
Classification Level Classification E-value
Superfamily ApbE-like 4.71e-48
Family ApbE-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ABX80696
Sequence length 360
Comment pep chromosome:ASM1878v1:Chromosome:63791:64873:1 gene:ACL_0054 transcript:ABX80696 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:apbE description:thiamine biosynthesis lipoprotein
Sequence
MKKIWAVINLILISVLFSACTQQAIDNSLAISSMDTFIGGTVHAPKAVWDKADKKLKEMY
MLYHELTDNYRGYEGVQGVYYINNLVETTKTDQTVEIKKELYDLLSLGVELYEFTDGYFD
MSIGKIIDVWKNLIDESDYTGQEIPKEDIDYAINLVDAIDIIEDPVILSEVDNKYYVTLK
YGAKLDLGALAKGYVTQLAADYLTDLGLSTYLISGGGSSMLYGEGNPKTEDGSYRTGLIN
PQDVIDNLDIIGYRPKNYGIYTAKNYNFTTSGSYNQFILSEGVMYHHIVSPKTKRPVNHY
LTLSIVGTDAGFNDGLSTALFSMPPEVLEQFLETNGYEVYTYLFNNTYKSYNQSENFRPL
Download sequence
Identical sequences A0A2G7QKW1 A9NEB6
gi|162446940|ref|YP_001620072.1| ABX80696 WP_012242027.1.15573 WP_012242027.1.46366 WP_012242027.1.71135 WP_012242027.1.72193 WP_012242027.1.73551 WP_012242027.1.92431 441768.ACL_0054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]