SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ABX81937 from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ABX81937
Domain Number 1 Region: 135-301
Classification Level Classification E-value
Superfamily PEP carboxykinase-like 1.25e-37
Family HPr kinase HprK C-terminal domain 0.00000413
Further Details:      
 
Domain Number 2 Region: 8-133
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 2.22e-27
Family HPr kinase/phoshatase HprK N-terminal domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ABX81937
Sequence length 317
Comment pep chromosome:ASM1878v1:Chromosome:1403637:1404590:-1 gene:ACL_1345 transcript:ABX81937 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hprK description:Hpr serine kinase
Sequence
MAYKNSIRLKKIAHDLNLKIVAGFDGEDRRVEVEMLSRPGVEFAGFLDFFDPQRILLIGS
KEAHFLMLLDEQVQIERVDAVLKLQPPAVIFSINVDIPQYFMDLGNKYHVPLYKSNERTT
PINSKLYSYLRSALAPRESIHGTLLDIYGMGTLIIGKSGVGKSETALELIKRNHILVADD
RVDVYETAPGVIIGQAPKILERYIEIRGIGIVDVVQMLGAGAFRENKKIRLVIELEHWDK
SKTYDRLGIETQNYTIFGTEIPKITIPVLPGRNNATLVESAAMNQKLKYLGYNAAETLIQ
NVAAKAAKGAEDDDDDI
Download sequence
Identical sequences A0A2G7QEP1 A9NHV7
441768.ACL_1345 gi|162448181|ref|YP_001621313.1| WP_012243268.1.15573 WP_012243268.1.46366 WP_012243268.1.58935 WP_012243268.1.71135 WP_012243268.1.72193 WP_012243268.1.73551 ABX81937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]