SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMAG_01217T0 from Allomyces macrogynus ATCC 38327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMAG_01217T0
Domain Number 1 Region: 78-403
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.02e-112
Family TK-like PP module 0.00000000664
Further Details:      
 
Domain Number 2 Region: 416-604
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.11e-62
Family TK-like Pyr module 0.00000103
Further Details:      
 
Domain Number 3 Region: 607-738
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.76e-44
Family Transketolase C-terminal domain-like 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMAG_01217T0
Sequence length 748
Comment | AMAG_01217 | Allomyces macrogynus ATCC 38327 transketolase (749 aa)
Sequence
MSAPAPSSDPTPEPAAATMSLTRQRPRSFIARAFSYFKSHSGLPRRASTSQLSRSSSTAA
STCSSNMSATTFDATDALAINTIRCLAADMVQKANSGHPGAPMGCAPMAHTLFSRFIRCN
PRNPKWINRDRFVLSNGHGCALQYVMLHLLGYDLSMDDLKAFRQLGSKTPGHPEAGHTPG
IELTTGPLGQGISSAVGLAIAEAHMAATFNRPGFELFDNYTYVILGDGCLQEGVASEAMS
LAGHLQLGKLIALYDDNHIQIDGDTELGFTEDVCKRMESYGWHTLVVSDGDSTNPIAIAQ
AVEAAKKVTDKPTLIKVRTTIGFGSAKAGQEKVHGSPLGAADLAHAKKTLGLNPDETFQV
PQSVRDLFAKITARGVAAEEAWNTLFKQYQQAHPELAAELARRQKGELPAGLKERLPKYT
PADAPVATRKLSENLLNAVAEHLPELMGGSADLTGSNLTRWKTATDFQPPATKLGDYAGR
YLRFGVREHGMAAICNGLSAYGGFIPFCATFLVFAQYAAGATRLSSLSHHQVLYVMTHDS
IGLGEDGPTHQPIETLAVLRATPNTLVFRPADGNEVSGAYWAALTASHTPSVFALSRQNV
PHLEGSSADGVTRGGYVLSEAKNAQITLVGTGTELSLAVDAAKKLREQGIVARVVSLPCW
QLFDAQPRAYQDEVFPAGIPVVSVEALGVFGWERYAHASVGLHGFGASGPAPQVYKQFGI
TVEGLVEKAQATLKYFAGKPVPNKLDRI
Download sequence
Identical sequences A0A0L0RZ11
AMAG_01217T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]