SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMAG_05242T0 from Allomyces macrogynus ATCC 38327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMAG_05242T0
Domain Number 1 Region: 238-528
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.09e-79
Family Cryptochrome/photolyase FAD-binding domain 0.0000225
Further Details:      
 
Domain Number 2 Region: 11-192
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.79e-42
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMAG_05242T0
Sequence length 568
Comment | AMAG_05242 | Allomyces macrogynus ATCC 38327 cryptochrome photoreceptor (569 aa)
Sequence
MPPATTNLARNVLMWFRRDLRLHDNPALLSALGQPDRIPAAQHLYPVYCLEIPTKKKCGH
RRWIFLLECLHDLDANLRKLGSRLFVVRGLAPDVLPLLVQHWNVSELAVGECHEPFAVAR
DNDVAQQIAPHGCDFKSFPGRTLFRPQDVLARTGNGKAPLTMAAFSKIAERLPVPTPVDA
PASLPSLGDDAITALRNALDPATFDALAGPQGDFSVPTIEPDGTVPELHLTTPIPAHEQS
PHRGGETEALRRLDAYLSDHARVTQFEKPKTSPAAFYPNADTTILSPYTTYGALSVRTFR
AGIDRVYRAAKGKHSKPPVSLLAQLYWREFFMTAGATTLNFEQMRRNPICLQTEWKCIPG
ETTRESHPDDYAMLDAWAEGQTGYPWIDAIMVQLRREGWVHHLARHSVACFLTRGDLYIS
WERGAEVFEDLLLDHEWALNRGNWMWLSASAFFHQYFRVYSPVKWGQSWDSEGVFIRKYL
PVLRKMPKQYIYEPWKAPIAVQRAAGCVVGVDYPKRIVDHDVVVKVNMTKMKTSHAAQRE
QAAMENGDSNGGRNGTRERSGNMRDRPL
Download sequence
Identical sequences A0A0L0SB33
AMAG_05242T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]