SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMAG_06543T0 from Allomyces macrogynus ATCC 38327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMAG_06543T0
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.53e-29
Family Skp1 dimerisation domain-like 0.0000491
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily POZ domain 2.54e-21
Family BTB/POZ domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMAG_06543T0
Sequence length 161
Comment | AMAG_06543 | Allomyces macrogynus ATCC 38327 glycoprotein FP21 (162 aa)
Sequence
MVKLLSSDNEKITVAQDVAVRSMLIKNMLEDIGDAEDAEIPLPNVTARVLKKVIEYCEHH
KNDPMPPAEEDELGDERRRSDDIDEWDADYIDVEQELLFEIILAANYMDIKPLLDLGCKT
VANMIKGKTTEEIRKTFNITCDFTAEEEEQIRRENEWAEDR
Download sequence
Identical sequences A0A0L0T7D0
AMAG_06543T0 AMAG_15409T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]