SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.03268 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.03268
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.2e-58
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 203-271
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.000000000036
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.03268
Sequence length 274
Sequence
MRSKFLVSDGGVHAHINHLESLIDAAKELSVPKCFIQFFSDGRDTSPTSGVTYVDRVLKK
LKEINYGSLATVVGRYYAMDRDKRWERIKIAYEGLTQGKGEATTPDKLIEVIKGRYEAEG
DKHETDEFLKPIIVDPEGRVKDGDTLCFIDFRSDRMREISEAFGIKPPFETDVIPKDLHQ
ITMTQYKKEFPFPVLFPPVVLTNVLAEWLSSENVPQFHCAETEKYAHVTFFFNGGVEKQF
EGETRSMVPSPKVATYDLEPEMNAEGVGQEVMND
Download sequence
Identical sequences adi_v1.03268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]