SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for adi_v1.20605 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.20605
Domain Number 1 Region: 82-131
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000254
Family Fibronectin type II module 0.0026
Further Details:      
 
Domain Number 2 Region: 12-70
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000115
Family VWC domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) adi_v1.20605
Sequence length 132
Sequence
NKTLIVHLPDKANCYYDGILHEHGERWSPGPCTPECKCDDGKIHCTLIECPELSCHNPIK
KRWKCCPECPAEEGLNARCIETDGGTSNGACCVFPFIYHGVQYFECAEDQNKKPWCATTS
NYDIDGMWGHCL
Download sequence
Identical sequences adi_v1.20605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]