SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.05536 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.05536
Domain Number 1 Region: 1073-1275
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000916
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 2 Region: 847-1066
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000209
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  adi_v1.05536
Domain Number - Region: 305-444
Classification Level Classification E-value
Superfamily Tropomyosin 0.000719
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 693-804
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.05536
Sequence length 1424
Sequence
MNKTNYTQEKQYILKQLAMAKETLAKLRASTLVTNTTDNTFNGAGGGDLFGTESISGWDD
YKHDSDERSSGLGMESPHSEFRGETSNDDKSTFARERLANVLGLQVSKLEDDLKASLLAY
LEEMEEQKEELISCFETMHTQLSKHHQICQEHYEEMARKDERIGKLKMEKQTIEIEVENL
RRENVKIKASKTCIRENGYRISPGYVEPDELSETLMKENSHLREKLQKYETEDHAKMERK
IESTLETEALTAIEEPLIRESILQLDLGTSHVNAAEYLKYEPVRSQTDMIDQPDVLKSQN
SPEGINFLQRKIDELQTEIQNHDERLVTMNSKNEDLQCELTKAQDILKSERDNASQEIEN
LHNEIEQMKRKIRDYDTSLAEAKKENGSLSQDLQQAMDKSKEDQEERKALEQRKMEYQER
AEKLEGQIRDLNANLESKNKENRATMEELIKKQENEEQENINECLQRQNEELSYYETSLQ
NANKEKDELLSELAEAKDSVERKERERKVEEENREALQKIMQEELSAKDGEVAKLQKELV
EVCEEKERLSSLFDSFRETRTQTEDQLQSAQKTILDLEKQESTSRAKEKSLQQLLQQSEE
SNTNLQIQLGEAEKACKRKDKETRALQQQINLSQHGSVELQREVEDLRAKVAQEKAKLKQ
NAKNLQELQKENDHLRTQLEDSERALENFHQKNEKMVLQMEEAIRERDNDIEELKEEILL
SEQHVHEIKSLSNDKQTKLSDLQAQLIESKEQSFSLSQEKAKLLRDLKEIENDVTDKEQR
ITVLEMGKTEDRRIVSAQEERIDEFLSKLQEIENEASNLRKENERWKNSSEEASNNITEL
DILLKETQNEKKDLEQQLLAAHESIADLETAFERGEDKISTTEDNLRVAKDQIAKLETQL
EARQVEYQALERDYNETEREIEKSQETLHSYQNKITSLEKKLRDAEANMSELEMARDNGL
SNEQLLQQRFAKAREDIGKTEAENFELKEKLTKLERKLADVLSKQAVLEERKEELDKVNK
ELHKDMEYEREKRLALKQKVELKDRENDMIQRKIQNLEKSLTEHQELQSKGMEEKAKLRD
ELARTKKSVSELETTKENQEESISEMEETLRETRGKMTTLEQSLEDTKRESMDLHEEVEE
LNRKLKYVKEENCELEKSLQIQKDISDGLRNNLAERDESVMASNYNRDVVERNLQTLKKD
LAKKDTKLKMLQEQVEDLDGDVEKAGRKIKETEASNKKLTSEKDRLTKELADMRVKLAKA
ERSTVVSESEVPVVRVSEVQDTPVNAEKLIRDWSDKLNTAQTKVDDLESELLKDIKKHEA
RVHRTRPIPPDLRRKSADFVLANHERPSRFRSRQRPTLSRDSSHSYDFGNRDSHSFRTQY
PAYNRLRKSRGFGNRRTKWCPCEEGSCGDKSYGEDNRKKRTNER
Download sequence
Identical sequences adi_v1.05536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]