SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.05537 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.05537
Domain Number 1 Region: 525-778
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000144
Family Tropomyosin 0.00053
Further Details:      
 
Domain Number 2 Region: 838-1083
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000281
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  adi_v1.05537
Domain Number - Region: 337-430
Classification Level Classification E-value
Superfamily Tropomyosin 0.000185
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 14-282
Classification Level Classification E-value
Superfamily Tropomyosin 0.000432
Family Tropomyosin 0.00096
Further Details:      
 
Domain Number - Region: 1390-1459
Classification Level Classification E-value
Superfamily Tropomyosin 0.00281
Family Tropomyosin 0.0059
Further Details:      
 
Domain Number - Region: 1002-1237
Classification Level Classification E-value
Superfamily Tropomyosin 0.00288
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number - Region: 1260-1490
Classification Level Classification E-value
Superfamily Tropomyosin 0.00451
Family Tropomyosin 0.0033
Further Details:      
 
Domain Number - Region: 424-553
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.05537
Sequence length 1492
Sequence
MESEGKLSKQQNDELKRENDNLEKKNRDLEELSKKNERERKEARHELLTAQRKLADFQYK
YDFESNERGTLSSQLETANSEVSAALDKALNLEQKIVEQKLLLEMTSKEVDEKELVIQQV
KNSKHFVEQQRDNLKQNIASLKEEVERLQQEIVRLQHENFEQHKKTTDLDSKLWKAAAEK
ERAREEASKCKEDVVTLKRRLDESQAETDNLEYQIEEYKQTATKYKNNMITYQREVTELN
GQCDVFKETLEAREGSITQLKDSKRILEDEIKGLKNALKEKQTENDLLMTKRKELESSLS
SAVQRLAEAESSLKLKNENENLNKVGLSSKDVAADLRERYQVLHRDYENREYEFMGLQQK
VTYLEASYTAVVDDKDKLKEEYMTLKRDSSEMRISLDNSQREKNKVEGELSLIKQQRSDL
QKRLSDVLLEKDMPSAKQVNSAPDSVQEEYTSALSEKEEKENEIMSLNKKLSKLELELGE
YDGIKTNLQGEVNTLQEKVQELEQTVAYLEQKDKDFQQESIDSLKKITALDQELIMCKNK
VTRMEAFSVVNENKIKSLSDDLFDAEQKMSKLELSLHSSQEKESQQQRDLLDALKKATDF
EVAYNSSQSAKNQLQKDINTYKNKLTTCERELQKEIKERSNLESQLQEVKSKVDDLKSAA
IRNQKKFAEQQQQSDIKLRDCETKLATIDKLESEKNSLENEVASLKKDLTDAKFNSEKLD
YKNKELKHQLEASKERLEDVESEADINKRECDKLRNEITLLETSNQETKLICEMLRKEKD
GLDYQLLESTTTEDDFQTEENSLKKEKDELENQLNKFKSELQSQKSIQEEIVAGKTKAEE
QLTALRRELVEAKDNYQAARRDCNQISLELESYKKQLIDLEENYKRLGLDKETIQSEASE
VQRKLALVEANYELCENQKGDLRREVQNYEKKLALLECSYNRVLKREEELEQETLESHKR
FTELEHELQTKEEKLEQMQNTVQEMEEKNDLLQIEIFDFQSKVRELEAICDTWKNKASQW
EDEAEAAERRAKDIEECNTFERLEKSEQQNALANLRVNVSTLERELKETKKEKDDILGEM
DDLRNNSLSDRDNVNSLKKQIKELENKLADSSRQMEDKDVKLDDLKRQEALLADMVETLK
RDLQEKERSHEEYTRESETIKKEIEKLTEELDEKESKLKECEDEKEKLRNEKISAHNVLC
TLQVSTQTNEVQNEIMQQEGDYFRKKVEDLELELETYRTRNITRNQDGSSPETVTHSEIE
KLKRELSLNKYEYDSFETEKDSPMEELSAMKQSKSETQDQLGRVTRELEKLQREASQREA
HLESLEREKTSMQEEINNWKLDNSNHIQEILDLKEEIARLQTQMTVKENIADEAGDARKE
KDKILYEYTMIKEKYIMIETEKETLIHEKQTLELDLSEFRNTVERYEDSVRKLEEEKRKL
EFEVETGKERLSIMEREFDSRTAEKKYISEQINITHMELIKLETIYKTLTED
Download sequence
Identical sequences adi_v1.05537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]