SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.11516 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.11516
Domain Number 1 Region: 695-796
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-24
Family PDZ domain 0.00019
Further Details:      
 
Domain Number 2 Region: 246-345
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.64e-23
Family Ras-binding domain, RBD 0.00025
Further Details:      
 
Domain Number 3 Region: 388-494
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.88e-17
Family FHA domain 0.000075
Further Details:      
 
Domain Number 4 Region: 47-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000641
Family Ras-binding domain, RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) adi_v1.11516
Sequence length 1667
Sequence
MPENDINGMRPKEDEREYLRKLIAEWNASRMDLFAISEPGEDLEYRGVMRFFFQDAGAKM
ATKCVRVTSVETAEDVTNVLVEKFRPDMKMLTNPNYSLYEVHPNGDSRKLSKEEKPLVVQ
LSWLEDDREGRFLLKSDSEALVTTNVFNTENDPGQSFRRRLSKREKKELKKKKEEDAKKA
KILGPPSPTKSSDDSAIAQTLYNELPETSFTRSISNPEIVMKMRRQRKLEQKLKEFQSSE
GVADSGGTLKIFAETLKPEIPYKTLLVSMRDPTTYVVKEALEKYKMEKENPEEYCLVMVN
IPPEGANGTNVLGKERIVHDEDNPLAIAATWPKNQGHVVFHLRRRANMPQYRKQKRRSKS
PSRVPQDKTPEKGVGERLANNPFPEHLLPYLRELTSDGHELDYRGNEHRLPMEVTEVGSE
KSMSSGGSYLELFAPHILPRHCVITNMDGIVSVTPTSGDAEVYVDGKRIYESTRLNHGST
IKFGRLHTYKFGDPAYEENSNLPGSPGREESVSSDSDSQRRRESRSGPRGMNREYEQNNH
ESGLFETTFGVDGEVETYTNEKACGTCLFCGGLFLHGIGGRRRHGKPTISEILFTLSSAM
SLLRRCRVNATLTIQVFSHLFHYINMWIFNKLVLQPQLGLCTRDWGYRLRRRLGRVESWA
QKQGLELAADCHLCRVVQVCKXWIRDENHSLQGGDVSPRSPQAPEIMEVSFYKGQGGMGL
SIVAAKGAGQDKLGIYIKQVVKGGAAAKDGRLQAGDQLLTVNGESLVGVPQERAAELMVK
SGANVTLRIAKQGAIYHGLATLLNQPAQIVTRDPLQNLIVVGNEDLVEASPTIPEQEMQR
PPGRWLPPGRSQSLNRWGEEDRGRPTYQGQWEIEEDRRKRDADEERRRIEEQRRQDEEER
RLEQEKILAEHERLFREEEKRLAEQRRQAEEQRRLEEERRQEDERRLQEQRRRAEEQRRL
EEERRRAEEQKRVEEERRREEERRLEEQRVYAEEQRRIEEARAREERRLAEEQRRLDEER
RREEEQRQEEQRRFGEDRRRLEVERKRGEDALKMIGQQQRRQKPSVSRASPQTIQVEVVR
PPARAEKERSPLTVKVAEPEMVPQKRNNYYSSPTSAGSLSPKRESPRDKEERKADGLVSV
TRVKYHAPDKEERMERGRKIDLLLDETMRRDRERKEAERWRQQKGEDEEKLRSERQQRLS
QQLETDREQQRESQRRLREQRDKEQEEWLKEQREKRDQLRIDQEKMRLEKKMQEEEDRNK
KRQEIQQRREQEELLRRESEKQKQEQERLLAEEKRNAELRRDIERKKQFEEQRIVKEKEE
QLRKQLLEGQQQQEGRTRKPSTEDHVSELKSRATADYERRRKLIDVEVSRQRPEPVSALK
NPSLPKPKKQVSFSNVATEISDPTSSYVVGSSAGYTARVTPAPSIKYVNTRAPIDEPDAG
RPPILDDDDELPPPPPPPPPPEELLEDDNLPPPPPMKSQQSYDRFSALSNDRSRSLGYSS
RVTVTSQGPPEYPPAYSNAGIPLRQPPVTSSSAYPSYVTLPRKPRPVSYPNAFEMNQQGP
AMVPTRYGSQENVLDGPGSRPQPPPSYAPKPARLDSAQLNGPENARGRLARMSLTDEEKS
ESQFVSKKPENLHFRDKLKMFNKESPEEKVRASKWQQEQLSQINGDY
Download sequence
Identical sequences adi_v1.11516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]