SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.12012 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.12012
Domain Number 1 Region: 17-122
Classification Level Classification E-value
Superfamily ARID-like 7.33e-34
Family ARID domain 0.00038
Further Details:      
 
Domain Number 2 Region: 181-204,288-417
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000983
Family Mo25 protein 0.055
Further Details:      
 
Domain Number 3 Region: 517-591
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000101
Family P4 origin-binding domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.12012
Sequence length 1008
Sequence
MFQPSHFQKMAKHLGIDSLTYEKEYNGFMAKLKNFHESKGTPFRRLPWLGGQYLDLYLLY
RKVTSAGGWVKVTEGKMWRDIAEVFNLPPTCTNAAFALRQHYSRYLEKFERINFFGEDAE
DVLTAGRPHTPVGGGTFPTHAPSVTATDYISVISSSKDPSRNFDKLVLSLQCGMPNEVDF
AINICMLLSNVSNSVFNLSKAPAVIDTLLAHIGVFSEELHGLRELHEEWYFKQHMDRDFT
QFWKESISVEEVQEIFSGSHCQDKEVPWRESLFHPARRKAGARAAECQRISQVFLVLCIC
SDYGFLQRMAWETLSNLSEKMSLEPLESSTTQMFFQILHFFLDHKDRYHVINAMSVLGKL
CTVEGNDEIVEAGLEPEAYQSLIKVLVVNDVQLVLSSLESLYNLSGIGQATSHHIAEVHH
SIDVLVCLVTMDAECFGPEALSEVQIFEKRIPTPIPSAAKPQSTPAPVVQPPPKEPAVQH
QLPQTSSPSPGPVPSPSSNPVPIKTTGSEIDPEAFTYSWLQGTYEASPGSSVSRIDIYAD
YLSSCSKLARVGILNATAFNRIIKVAFPDGQLRRVTSGVNVQYVLAGIKRKANPLPVKSR
TDSPPVSGASTSHSLQQRVPQVEQNVPRTSSLPAANQVLPSRSTPRPQLPPQTMPISFDQ
RSGQVPGVTQQQQPSAIRQVARKPSFSNEGTLQTTFSQGTRQVVASEAAGQQNLPANADL
RQVVGRQVQRGIVVADKGQPMKTLEATQRPNKDAVKPNQIPQSFPHQSPAQPSQRVPESP
RQGAQQQSASHHIQGGQHMIQTVPLLSGQRGASQPASASVLGSQLPRSPVPPQRPLQSPI
AQSSRTQPPTGFMPRVVPLGQQPLYPSPGVHKQPAPGISLQQNQRPAPPAYNSRPAYQST
AYPRLAPKPTAGVNVQISQVANQVPLISTVVGGRCINSQVAARPSMPPQNSMPQSPATMV
PSSLQSTPVPSGQQVANSQHDLPGGFGGSIRPKATQDVRQTKKDSAKG
Download sequence
Identical sequences adi_v1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]