SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for adi_v1.13077 from Acropora digitifera v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  adi_v1.13077
Domain Number 1 Region: 83-365
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.57e-30
Family Lipovitellin-phosvitin complex, superhelical domain 0.0012
Further Details:      
 
Domain Number 2 Region: 374-673
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.61e-30
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) adi_v1.13077
Sequence length 823
Sequence
MHLGYKVGQRYTHSYECDVTKAMPGSSAKTVGLQLKLFIRMLRANTNRQTLKFLKNTAAG
APSTELTETVRMTFSAENPEAFSKYQKQQQQQIVKAARECIQEMFKAAKDIAGPNVGEKF
AATVSALRRCTKETLKTLVDEMVKRKDQTERKLFLDAASFVGTCQAFEVLKENAQLFKTS
ELSRLFLGLAATPEPRACHIKALREMRSRLNKENAKSDEKRMYIQALGNAGSCQAQDDLQ
NILKNKQQPLFVRVECVWALRRITRQNRGKAKAYPCLISIFADPEESPELRMAIFVQILN
TGPNFPTLQALASIVRREVSIGHKGPQSNQLASFVFSHLFALAYNNNILTKRSRAMQARL
VLRLMPEMKYGLSYSKGVRMAFNSEKYQSGIEIEANKLDLPDSGLPRNLNARLRFNILGY
RLNALEFGARIENMDDIVDYIASKIHKRSKRSHGVKIEQTLQKAFLGYHARHMIPTLAGI
MLDMEFRAGTSAIARTTANFGVSSSSWLTFWQYNKMTGNLRITPRVNTHAHALVGIHTPL
VRVGIQMKLNIRSYFDKRANVVAEKGKQCSVKFNIPDRKWDVWTVKVDTEGFTQECNPDT
LKTTEKAISMELNRDHITQLQRRCYGKDMFGVQYCVQGTFPDLTALRLQQVQLLPVIGQF
DGRFTGEPAEDKPTDIEWLHKHPVISKLGTQEIHGEINVLAASKAVTRKIPYKITYNRGH
QRELLIKFDDLQVKGYEKAMMTLKVDSNGLKLNFGNKAGQKGPKYEITVSGQVENQGKCL
RARARWNMLPEQWKDFLYQWEPQIWNALQQFAWTLREQTSGYH
Download sequence
Identical sequences adi_v1.13077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]