SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ARB_03635 from Arthroderma benhamiae CBS 112371

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ARB_03635
Domain Number 1 Region: 139-449
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.57e-54
Family Glutamine synthetase catalytic domain 0.001
Further Details:      
 
Weak hits

Sequence:  ARB_03635
Domain Number - Region: 37-126
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0929
Family Glutamine synthetase, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ARB_03635
Sequence length 455
Comment | Arthroderma benhamiae CBS 112371 hypothetical protein (456 aa)
Sequence
MAPHANRAKVDDAKANSMAGTGGSNALHALLTLYPSICFLRCQWQDYSGVVRARIVPMEQ
AQAIAAEKRRLHVPACAFHLTVSHENIPEMDPRGYHWLIPDWDSLYPASQQLGVDPSYAT
VMCGVVEHLPIRPELNWNYCPRKALKTVVEKAEKLLHVHFLVGFEVEFQVMKAAADGKIG
PHSSGLGRCAISGLRDPCVAHIQEVVHILIKAGVGVGAFQTEGDRGQYEIALEPQSPLRA
IDELIFVHDTLKSVFARHGLIATMAPRPVASHKQVAGQHTHISLNPPNKETSFLAGILRR
LPGLCAFFLPYDLSYERVQPYLAGHIVAWGSENRAVPVRQIKSGHWELRCVDATANMYVA
LAAVISAGTIGCINEEPLVWPDTGLITEHFPTSGVEPFPKSVAGSLEQLEKSCDSLQEFM
ESRILRHYIAVKRYEAPRLQTLSEETVRQLLCEIF
Download sequence
Identical sequences D4B595
XP_003010129.1.35196 ARB_03635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]