SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ARB_04864 from Arthroderma benhamiae CBS 112371

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ARB_04864
Domain Number 1 Region: 82-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-42
Family C-terminal domain of adrenodoxin reductase-like 0.0000135
Further Details:      
 
Domain Number 2 Region: 11-139,329-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000561
Family C-terminal domain of adrenodoxin reductase-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ARB_04864
Sequence length 471
Comment | Arthroderma benhamiae CBS 112371 hypothetical protein (472 aa)
Sequence
MGKVPEAIIDMYEQLPVPFGLVRYGVAPDHPEVKNCQDKFTEVATSPRFNFIGNIELGGG
LPLNSLKPHYDAILFSYGASKDRELGLPNERSLSGIFSARAFVGWYNGLPEYRNLSPDLA
SGEDAVIIGQGNVALDVARVLLSDVDVLRKTDMSEHALEELTKSRVKRVRVVGRRGPMQA
AFTIKEVRELMQLPSVGFEPIPSNLLPPDSIISGLPRANKRITQLLAKGSLTSLDSSAKK
WSLDFLLSPRSFHSSSEHPGRLSHITFSRNQLDPADPYSPSASISPHLADDGKVAHIDIS
ASLCFRSIGYKSCPLPGLNELAVPFDASRGLIPNDGQGRVLNTIPSVSEGDIIPTHVPGV
YCAGWVKRGPTGVIASTMTDAFATADAIAADWEVHRDRGSNKMEFLNSRSGEESTGLGWD
GVRPDAEKRGLRPTNWKDWEEIDRAEKERGQTKGKPREKFAQVNDMLGVLA
Download sequence
Identical sequences D4AKM1
ARB_04864 XP_003016575.1.35196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]