SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ARB_00775 from Arthroderma benhamiae CBS 112371

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ARB_00775
Domain Number 1 Region: 1877-2174
Classification Level Classification E-value
Superfamily BEACH domain 3.4e-121
Family BEACH domain 0.0000000451
Further Details:      
 
Domain Number 2 Region: 1714-1842
Classification Level Classification E-value
Superfamily PH domain-like 4.36e-23
Family PreBEACH PH-like domain 0.021
Further Details:      
 
Domain Number 3 Region: 2232-2392
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.09e-21
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 4 Region: 331-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000001
Family Laminin G-like module 0.061
Further Details:      
 
Weak hits

Sequence:  ARB_00775
Domain Number - Region: 194-327
Classification Level Classification E-value
Superfamily ARM repeat 0.00144
Family MIF4G domain-like 0.074
Further Details:      
 
Domain Number - Region: 943-983,1048-1064,1094-1456
Classification Level Classification E-value
Superfamily ARM repeat 0.00475
Family MIF4G domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ARB_00775
Sequence length 2410
Comment | Arthroderma benhamiae CBS 112371 hypothetical protein (2411 aa)
Sequence
MSGAQPRSRVSSSTISVERLTPKLQPAIDGLASCCHNLPGSIEEASEATEHILLIHHTLI
DDHQPQEAKSLFRQLRGFEHVLGLLERLADLYKPDTIGDADGKLLLSIIKDSLCIVAESL
KDDPGNKRYFGKRDNVAGIIAYERILSGLAVKLNNTQDVELLYGGLLAAGLGNETMSQFF
STVRKKAEDAESNTLLSLSELVNRSLGTGEVVENPEFFGPLLRLWLAQTAEQETYPILRL
SVPLCLTRLASLSQRNCLALHSTGILSPLLTLVTVPERSKDELEAYLKLATILCQHGVNS
LQDAIQLYQKAQKAPQVSRFLLDALKSSKSPPCVHFDLSSHGYSSIELPTLGRPFPSITS
SGYTLTIWARVDKFEPDTHTTLFGAYDATQTCFLLVYLEKDTHNLILQTSIKGVRPSVRF
KAMKFLPGQWYHICIVHKRPKTLSLSRALLFVNGEFAEQLKADYPVVPRLRVNQKNPQIQ
AFLGTPRDLAVRVGKGVSSSKWSLASAILFDEAFNDDLIAVLCHLGPRYYGNFQDCLGSF
QTYRASATLNLRNESLHAGKEDQSDIVSVIRQKGSILIPESSVLLNISPTSVMDDDDTNN
IDESQLVKSLSKTAGKNLTQLTKVKGNSIVINGAVPAINEALTQPHGVAILTGDPVVIVP
QSLDDVSWRIGGCAGVHLSLVEAATTRESLHLALELLFEAVQDNWRNSEAMEKENGYGIL
AMLLREKLGFPSPVQSSPLKTTPVCSTTQERNEASMELLLPILRFVGYDFENPKKSLIIN
PLAYRILLIDLDIWRQADLPLLEIYYSQFRTFCVESHYHRFNSKRLSRMRVIKRLIEALK
AEIFTTATLKLFVAAFKSLVGACMTAEVLRSVSLFITFSIHSAKQRVNKTNKNRNTRLDI
RSRRTGNLYPDHVPGYVSKEQIGVEILRVFTDVFCNSEDTASIQKFARTVTNKWLLYLLS
EDNPDVVILVTMILSRLFIVHGTAYTKKFAEKAGGFVVMRHRLKRWWNLAPLWPLCFSIL
FGLDPGSINLDKTSGTSDLQRLLSSPEALKVSFPEVLPVITGMLQLGLKASVMPRSGSPS
SHAEDDDGVTPGPVSSDHDILKSVVDFLAHIHEKSQNFRDFTVTSNYVEELLRALYPVVV
GSDIVNAGFELESNSEGLRFGGDSVTIQPLQGPRPIVRTSTVEGTDAQDNDNELHRSSSF
ILVSSNKSKYSPSPARLQQIVTPVPDAASPRPSNPVANDILDILLAVYTDQLFGRKEFPG
LQLFARIPPGFVEHQIYFESWILKNLLTHLEKKISKDKKVLTEPRVLNNLSRLLSYVAEA
VYGGWFIDGAMATLNFIGPVLEYLQEPDIASLKSVRLCSQTIAGIRSTVFRTVLLRLSAA
EGENAYTFLQQLTYWQTVLLSHEESPNEQLQLIYYLLYSKIVTEKENVRVAAAGLWRITL
VQKPSETSAILGQATPSLHRRLSLGFQKLVGMDDDSFLHWIDDQRDDLDCFFFGALCKGW
ESFVRDENTKTQETARIRASKRKEKLKQWTQTESINEEILRKHGITFGHWTANISVSEGL
KHQRAVQDQQDDFNFMASAFSRMYTNLRRENGFLATQSKHNWRLDQTEGRSRMRLRVTPD
DSTAKRDYQPKRKITNDTPEIKLDIRTRPAPNSDMINLSPPTIVPDSVDTDSLDNETEDK
SATEDSFELIDEPTGNDPYEDKNRKVMKNLQRGDQVQYVCNISRIIGLEACEGLLILGKI
SLYIMDNFFQRSDCEIVHVSQAHPDERDPYVRVISGRESDDRKHNNGAHRSRSWIWADVV
SVSKRQFLFRDVALEIFFSDGRSYLFTLISAKLRNELYNELISRAPQIHSSTSSTEDSWR
FETLRSEGNNSQFFGSKLVNVFSQMPSHPATRKWLKGEMSNFHYLMLVNTLAGRTFNDLT
QYPVFPWILADYTSEELDLTNPRTFRDLSKPMGCQTITREADFRSRYQSFAEMGDENAPP
FHYGTHYSSAMIVCSYLIRLQPFVKSYLLLQGGTFDHADRLFFSIPDAWNSASRLNMTDV
RELIPEFFYLPEFLSNSNNYDFGIRQSTGQSIDSVELPPWAKGDPKIFIAKHREALESPF
VTRNLHQWIDLIFGAKQRGEAALEAVNVFHHLSYRGAKDLDSIEDPMERLATIGIIHNFG
QTPHQVFHKHHPGREEIQNKPIRLDSSADSLTRLPFTLLDIQERVASLSFSVKQDRLLCA
AAFRLNIPPTYDKYMEWGFSDGSVRFYAAESRKLIGHFEHVHIGQLSCAIFADSQTLITA
GTDCTIAVWSFTSTSRSVDLLPKASLFGHRSPVTVLAVSRSFSTILSASKDGQVMLWDLN
RLEFLRELSTGPPVSSDDNVLSCAFYEGVGNEWLERELFFTGHRKGLVNVSDRFGAHFLP
YFADLATNCG
Download sequence
Identical sequences D4AX48
ARB_00775 XP_003012893.1.35196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]