SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G10710.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT1G10710.1
Domain Number - Region: 89-161
Classification Level Classification E-value
Superfamily PH domain-like 0.000221
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G10710.1
Sequence length 410
Sequence
MAGSLTASNRRRNAEDSSEIYRWTIGFARFVHYPSSPSPHPVLKPLGKREQYHSPHGTWL
SASSSTVSLHIVDELNRSDVILSVKLGQKVLEEHYISKLNFTWPQMSCVSGFPSRGSRAI
FVTYMDSANQIQKFALRFSTCDAALEFVEALKEKIKGLKEASTQNQKNKTRCDVSFQSDY
NPSDAIIPRATQKEPNMVRPLNSYVPEMLPRIVYEAQYQKSETRSEVSFQSDYNPSIEIF
PRATEEEPNMVRFFDSSVPEVLPRPEYEAGQALYPSQSTLNQIPSLPPSFTTLLSGCFPD
STLDAGQTTVKQNPDLKSQILKYMEDSSFQDMLQKVERIIDEIGDRCVGSTIGRSSKIYI
PLCFHNNCIHPFKDDCWCCLAAGTKKDWCWLEKDFPDAKELCMKTCTRKI
Download sequence
Identical sequences AT1G10710.1 3702.AT1G10710.1-P AT1G10710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]