SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G63490.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G63490.1
Domain Number 1 Region: 31-214
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.59e-32
Family PhyH-like 0.087
Further Details:      
 
Domain Number 2 Region: 1007-1055
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000247
Family PHD domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G63490.1
Sequence length 1116
Sequence
MYGNDLDTSVYGSGFPRIGDQRPESVEADIWDEYCGSPWNLNNMPKLKGSMLQAIRHNIN
GVTVPWLYLGMLFSSFCWHFEDHCFYSVNYLHWGEAKCWYGIPGSAASAFEKVMRKTLPD
LFDAQPDLLFQLVTMLSPTVLQENKVPVYTVLQEPGNFVITFPKSFHAGFNFGLNCAEAV
NFATADWLPYGGSGAELYRLYRKPSVISHEELLCVVAKGNCCNNEGSIHLKKELLRIYSK
EKTWREQLWKSGILRSSPMFVPECADSVGIEEDPTCIICQQFLHLSAIVCNCRPSVFACL
EHWKHLCECEPTKLRLEYRYTLAELDMMVQEVEKFGGCKTQETKISQRPSSGTKRSIALN
KKQEGMQVSQARPADKWLLRASKVLDAAFSSVEYATLLKESEQFLWAGSEMDRVRDVTKS
LNKAKIWAEAVSDCLSKVEGEVNDDSMKVHLEFIDELLRVNPVPCFNSGYLKLKDYAEEA
RKLSEKIDSALSSSPTITQLELLHSEVSRSPISLKKHEILSKKISSAKMLAKRAKRYLTD
AKPPGIEMDALFKLNSEMLELHVQLPETEGILDLVKKSESARDKSNKVLTGSLSLENVEE
LLHEFDSFSINVPELNILRQYHVDTLSWISRFNDVMVDVREGKDQRKLISDLSSLLRDGA
SLGIQVEGLPLVEVELKKASCREKARTVYTARKSLDFIEQLLSEAVILHIEEEEIFVEIS
GILSTARCWEERASTILENETQMYELKDLVRMSVNIDAVLPTLQGIENTISSAETWLQKS
EPFLSATSSMASSPCSMLELPVLKDLVTQAKLLNVQLQEPRILETLLLNCERWQCDNHQL
LQETEDLLDNAKIDDGTHSNILPKIMDLITRVDSARRSGLALGLNFDELPKLRTASLKLG
WCCKTITLSSSSPTSELLEDVGKPSLQHIQQHLKEGQTLEILPEEYYLGKRLMELKDTGL
EWAKRARKVVTDSGALALEDVFELISEGENLPVHAEQELQSLRARSMLHCICLKPYNSRS
MVSCSQCGEWYHTYCLKLHWRPKAYVCSACCPLAETTPQIDPARATEPERPSLNQRRTRM
VATDAAVNDLKWKTRKHIKRTTKRSPQVHILPWFFT
Download sequence
Identical sequences Q94BQ7
AT1G63490.1 3702.AT1G63490.1-P AT1G63490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]