SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G65920.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G65920.1
Domain Number 1 Region: 260-634
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-90
Family Regulator of chromosome condensation RCC1 0.00031
Further Details:      
 
Domain Number 2 Region: 15-125
Classification Level Classification E-value
Superfamily PH domain-like 7.92e-26
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 639-713
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.73e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  AT1G65920.1
Domain Number - Region: 791-832
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G65920.1
Sequence length 1006
Sequence
MGEQQISVTVPRDRTDEQAILALKKGAQLLKCRRRGNPKFCPFKLSMDEKYLIWYSGEEE
RQLRLSSVITIVRGQITPNFQKQAQSDRKEQSFSLIYANGEHTLDLICKDKAQADSWFKG
LRAVITKHHNIRNSVNHRSSRGAQSCINSPAGFMRRKQNLGLLEETPDVTQIRSLCGSPS
TLLEERCLSNGLSCSSDSFAESDALGPVSSYYETDYDFRNSDCDRSTGSELCRFSSQRFA
ASPPLSIITQPVTRSNVLKDIMIWGAITGLIDGSKNQNDALSPKLLESATMFDVQSISLG
AKHAALVTRQGEVFCWGNGNSGKLGLKVNIDIDHPKRVESLEDVAVRSVACSDHQTCAVT
ESGELYLWGIDGGTIEQSGSQFLTRKISDVLGGSLTVLSVACGAWHTAIVTSSGQLFTYG
SGTFGVLGHGSLESVTKPKEVESLRRMKVISVSCGPWHTAAIVETANDRKFYNAKSCGKL
FTWGDGDKGRLGHADSKRKLVPTCVTELIDHDFIKVSCGWTLTVALSISGTVYTMGSSIH
GQLGCPRAKDKSVNVVLGNLTRQFVKDIASGSHHVAVLTSFGNVYTWGKGMNGQLGLGDV
RDRNSPVLVEPLGDRLVESIACGLNLTAAICLHKEISLNDQTACSSCKSAFGFTRRKHNC
YNCGLLFCNACSSKKAVNASLAPNKSKLSRVCDSCFDHLWSITEFSRNVKMDNHTPRMQM
VTRRVSEDLTEKQSENEMQNLPQANRSSDGQPRWGQVSGPSLFRFDKISTSSSLNLSVSA
RRTSSTKISTSSESNKILTEEIERLKAVIKNLQRQCELGNEKMEECQQELDKTWEVAKEE
AEKSKAAKEIIKALASKLQANKEKPSNPLKTGIACNPSQVSPIFDDSMSIPYLTPITTAR
SQHETKQHVEKCVTKSSNRDSNIKLLVDASPAITRTGYLQNETQDSSAEQVEQYEPGVYI
TFTALPCGQKTLKRVRFSRKRFSEKEAQRWWEEKQVLVYNKYDAEI
Download sequence
Identical sequences Q9SRZ7
NP_176767.1.80155 AT1G65920.1 3702.AT1G65920.1-P AT1G65920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]