SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G71010.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G71010.1
Domain Number 1 Region: 1325-1639
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.81e-83
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0004
Further Details:      
 
Domain Number 2 Region: 396-568
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.3e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.0003
Further Details:      
 
Weak hits

Sequence:  AT1G71010.1
Domain Number - Region: 351-402,561-588
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000519
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.09
Further Details:      
 
Domain Number - Region: 44-86
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0219
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G71010.1
Sequence length 1648
Sequence
MGIPDGSLLDLIDKVRSWITSDSSDSLFLLSSSKQDFGIMPIVSKMCHDCGTKVEQGYCC
LSCGSCWCKSCSDTEESKMKLCRECDAEVRELRVKSYDKVHPRDSPDPPSSLATESESLA
SSLEIRDCRNMASIRCYPSRGEEEEARYCGKQLLSPSSDNYQDSSDIESGSVSARHELFS
CKSSAGSSPHDSPLRNNFSPLGRFVQHAKDLRSPTVCSFDNHQEQLLADNLVKPGQGVLE
QEDHEEEEDKLQQPLDFENNGRIWYPPPPEDENDDAESNYFHYDDEDDDIGDSATEFSLS
SSFSSHIPTKEKLGENSNEPLRTVVHDHFRALVAELLRGEELSPSDDGSAGEWLDIVTAL
AWQAANFVKPDTRAGGSMDPGNYVKIKCVASGNQNESILIRGIVCSKNITHKRMISQYKN
PRVMLLAGSLEYQRVAGQLASFNTLLQQENEHMKAIIAKIESLRPNVLLVEKSASSYAQQ
YLLEKEISLVLNVKRSLLDRIARCTGAVLCPSLDSISTARLGHCELFRTERVLEQHEAGN
QSNRKPSRTLMYFEGCPRRLGCTVVLRGSCREELKKVKHVIQYAVFAAYHLSLETSFLAD
EGASLPKIRLKQPGMVRTASQRRIIDEGISLITQSPTETDSQALLETAAHEDEHTAPMPE
HEVCESLCEDFDPTQIFPPSSEVETEQSDTLNGDFANNLVTRSYSSNQLNDLHEPTLCLS
SEIPETPTQQPSGEEDNGRGEEENQLVNPQDLPQHESFYEDDVSSEYFSAADSHQSILVS
FSSRCVLKESVCERSRLLRIKFYGSFDKPLGRYLKDDLFDKTSSCRSCKELVDAHVLCYS
HQNGNLTINVRRLPSMKLPGEQDGKIWMWHRCLRCAHVDGVPPATRRVVMSDAAWGLSFG
KFLELSFSNHATANRVASCGHSLQRDCLRFYGFGNMVAFFRYSPINILTVLLPPSMLEFN
SHPQQEWIRTEAAELVGKMRTMYTEISDMLNRMEEKSSLLEPEQSEACDLHSRIIGLIDQ
LVKEKDEYDDALQPIFEENLQIQGSLDILELNRLRRALMIGAHAWDHQLYLLNSQLKKAS
VFKTGDDNAPRNPEMHDPPKIDRRMQEGSDERDEQSHTDSEANGDNKDPENIPSPGTSLS
ERIDSAWLGSFQNLEKAETIAETEGFSAVNSSLRRLARPIRVQSFDSAIRFQERIQKGLP
PSSLYLSTLRSFHASGEYRNMVRDPVSNVMRTYSQMLPLEVQKLDLIVGSAPTYISSASQ
MADGARMLIPQRGLNDIVVPVYDDDPASVVSYAINSKEYKEWIVNKGLASSSSSSNLNNR
ESEPSAFSTWRSLSMDVDYIQHAVYGSSQDDRKSPHLTISFSDRASSSSTATEGKVKFSV
TCYFATQFDTLRKTCCPSEVDFVRSLSRCQRWSAQGGKSNVYFAKSLDERFIIKQVVKTE
LDSFEDFAPEYFKYLKESLSSGSPTCLAKILGIYQVSIKHPKGGKETKMDLMVMENLFYN
RRISRIYDLKGSARSRYNPNTSGADKVLLDMNLLETLRTEPIFLGSKAKRSLERAIWNDT
NFLASVDVMDYSLLVGFDEERKELVLGIIDFMRQYTWDKHLETWVKASGILGGPKNASPT
IVSPKQYKRRFRKAMTTYFLTVPEPWTS
Download sequence
Identical sequences Q9SSJ8
AT1G71010.1 NP_177257.3.80155 3702.AT1G71010.1-P AT1G71010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]