SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G23270.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G23270.1
Domain Number 1 Region: 210-596
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-92
Family Regulator of chromosome condensation RCC1 0.00031
Further Details:      
 
Domain Number 2 Region: 14-120
Classification Level Classification E-value
Superfamily PH domain-like 4.54e-23
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 595-665
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G23270.1
Sequence length 1045
Sequence
MADPASCYIYHERDVDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEK
GLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLI
EKSRNRRARSEIPEIHDSDTFSVGRQSIDFVPSNIPRGRTSIDLGYQNNSDVGYERGNML
RPSTDGFRISVSSTPSCSSGGSGPDDIESLGDVYVWGEVWTEGILPDGTASNETVKTDVL
TPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFL
ALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQV
LSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIW
HTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACG
HTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLT
SRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIHKWVSGA
DQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKL
KAAESGYSSNVNRNVATPGRSIDGSVRTDRETTRSSKVLLSANKNSVMSSSRPGFTPESS
NARASQVPSLQQLKDIAFPSSLSAIQNAFKPVVAPTTTPPRTLVIGPSSPSPPPPPRSSS
PYARRPSPPRTSGFSRSVIDSLRKTNEVMNQEMTKLHSQQRCNNQGTEIERFQKAAKDAS
ELAARQSSKHKAATEALKSVAEQLKELKEKLPPEVSESEAFESINSQAEAYLNANKVSET
SPLTTSGQEQETYQKTEEQVPSNSSITETSSSSRAPSTEASSSRISGKESKEQFEPGVYV
TYEVDMNGNKIFRRVRFSKKRFDEHQAEDWWTKNKDRLLKCYSSNSSSSSSSSNPTASDS
PVAPQPPSDPSVPEQSNEKEPDSET
Download sequence
Identical sequences F4J2Y2
3702.AT3G23270.1-P AT3G23270.1 NP_188968.1.80155 AT3G23270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]