SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433656689|ref|YP_007274068.1| from Vibrio parahaemolyticus BB22OP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433656689|ref|YP_007274068.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily MtlR-like 4.32e-58
Family MtlR-like 0.0000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433656689|ref|YP_007274068.1|
Sequence length 176
Comment Mannitol operon repressor [Vibrio parahaemolyticus BB22OP]
Sequence
MADNINETEIIERLNSAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQD
SGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNQLNSDASDYEFTDPNILEPIKKLH
LVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGKDSPF
Download sequence
Identical sequences A0A072G9C2 A0A0D1ETT2 A0A0D1FUW8 A0A2H1B232 S5J359 X7R4P0
gi|433656689|ref|YP_007274068.1| WP_005392227.1.100143 WP_005392227.1.100373 WP_005392227.1.100407 WP_005392227.1.100494 WP_005392227.1.100563 WP_005392227.1.100929 WP_005392227.1.100951 WP_005392227.1.101108 WP_005392227.1.101317 WP_005392227.1.10139 WP_005392227.1.10142 WP_005392227.1.101469 WP_005392227.1.101501 WP_005392227.1.101665 WP_005392227.1.101701 WP_005392227.1.102109 WP_005392227.1.10270 WP_005392227.1.10528 WP_005392227.1.10531 WP_005392227.1.10550 WP_005392227.1.10558 WP_005392227.1.108 WP_005392227.1.10872 WP_005392227.1.11159 WP_005392227.1.11352 WP_005392227.1.11583 WP_005392227.1.12087 WP_005392227.1.12539 WP_005392227.1.12658 WP_005392227.1.12933 WP_005392227.1.12994 WP_005392227.1.130 WP_005392227.1.13068 WP_005392227.1.13482 WP_005392227.1.13595 WP_005392227.1.14593 WP_005392227.1.14638 WP_005392227.1.14943 WP_005392227.1.15114 WP_005392227.1.15169 WP_005392227.1.15178 WP_005392227.1.15258 WP_005392227.1.1555 WP_005392227.1.15887 WP_005392227.1.16073 WP_005392227.1.16091 WP_005392227.1.16138 WP_005392227.1.16304 WP_005392227.1.17331 WP_005392227.1.17519 WP_005392227.1.17642 WP_005392227.1.17941 WP_005392227.1.18078 WP_005392227.1.18767 WP_005392227.1.19198 WP_005392227.1.20186 WP_005392227.1.20403 WP_005392227.1.20539 WP_005392227.1.20749 WP_005392227.1.21357 WP_005392227.1.21927 WP_005392227.1.22509 WP_005392227.1.22672 WP_005392227.1.22832 WP_005392227.1.22903 WP_005392227.1.23232 WP_005392227.1.234 WP_005392227.1.23592 WP_005392227.1.23893 WP_005392227.1.24049 WP_005392227.1.24073 WP_005392227.1.24359 WP_005392227.1.24486 WP_005392227.1.24639 WP_005392227.1.25315 WP_005392227.1.2532 WP_005392227.1.25353 WP_005392227.1.25430 WP_005392227.1.25436 WP_005392227.1.26160 WP_005392227.1.26203 WP_005392227.1.26541 WP_005392227.1.266 WP_005392227.1.26685 WP_005392227.1.26700 WP_005392227.1.26870 WP_005392227.1.27033 WP_005392227.1.27256 WP_005392227.1.27269 WP_005392227.1.27450 WP_005392227.1.2772 WP_005392227.1.27735 WP_005392227.1.28415 WP_005392227.1.28753 WP_005392227.1.28858 WP_005392227.1.28926 WP_005392227.1.2908 WP_005392227.1.29398 WP_005392227.1.29695 WP_005392227.1.29713 WP_005392227.1.29784 WP_005392227.1.29877 WP_005392227.1.29975 WP_005392227.1.30198 WP_005392227.1.30327 WP_005392227.1.30649 WP_005392227.1.30764 WP_005392227.1.31179 WP_005392227.1.31234 WP_005392227.1.31267 WP_005392227.1.3137 WP_005392227.1.31513 WP_005392227.1.31628 WP_005392227.1.31646 WP_005392227.1.31722 WP_005392227.1.31746 WP_005392227.1.31961 WP_005392227.1.32165 WP_005392227.1.32180 WP_005392227.1.32328 WP_005392227.1.32508 WP_005392227.1.32539 WP_005392227.1.32616 WP_005392227.1.32765 WP_005392227.1.32844 WP_005392227.1.330 WP_005392227.1.33209 WP_005392227.1.33572 WP_005392227.1.34116 WP_005392227.1.3423 WP_005392227.1.3431 WP_005392227.1.34806 WP_005392227.1.34889 WP_005392227.1.3498 WP_005392227.1.35169 WP_005392227.1.35267 WP_005392227.1.35320 WP_005392227.1.3554 WP_005392227.1.35556 WP_005392227.1.35973 WP_005392227.1.36072 WP_005392227.1.36197 WP_005392227.1.36274 WP_005392227.1.36530 WP_005392227.1.36619 WP_005392227.1.36623 WP_005392227.1.36716 WP_005392227.1.36760 WP_005392227.1.3684 WP_005392227.1.3696 WP_005392227.1.36970 WP_005392227.1.36990 WP_005392227.1.36991 WP_005392227.1.37000 WP_005392227.1.37633 WP_005392227.1.37737 WP_005392227.1.38461 WP_005392227.1.38922 WP_005392227.1.39181 WP_005392227.1.3940 WP_005392227.1.39791 WP_005392227.1.39849 WP_005392227.1.39910 WP_005392227.1.39977 WP_005392227.1.40049 WP_005392227.1.40051 WP_005392227.1.40273 WP_005392227.1.40386 WP_005392227.1.40684 WP_005392227.1.4076 WP_005392227.1.41062 WP_005392227.1.41418 WP_005392227.1.41441 WP_005392227.1.4157 WP_005392227.1.42059 WP_005392227.1.42185 WP_005392227.1.42292 WP_005392227.1.42884 WP_005392227.1.42890 WP_005392227.1.43067 WP_005392227.1.435 WP_005392227.1.43825 WP_005392227.1.43948 WP_005392227.1.43968 WP_005392227.1.44068 WP_005392227.1.44406 WP_005392227.1.44787 WP_005392227.1.4489 WP_005392227.1.44988 WP_005392227.1.45834 WP_005392227.1.45964 WP_005392227.1.45978 WP_005392227.1.4625 WP_005392227.1.46489 WP_005392227.1.46672 WP_005392227.1.46735 WP_005392227.1.47046 WP_005392227.1.47295 WP_005392227.1.47809 WP_005392227.1.4866 WP_005392227.1.48684 WP_005392227.1.48866 WP_005392227.1.4923 WP_005392227.1.49285 WP_005392227.1.49460 WP_005392227.1.49586 WP_005392227.1.50114 WP_005392227.1.50290 WP_005392227.1.5033 WP_005392227.1.50654 WP_005392227.1.51017 WP_005392227.1.51258 WP_005392227.1.51399 WP_005392227.1.51498 WP_005392227.1.51627 WP_005392227.1.51723 WP_005392227.1.51859 WP_005392227.1.51992 WP_005392227.1.5203 WP_005392227.1.52124 WP_005392227.1.52454 WP_005392227.1.5250 WP_005392227.1.53043 WP_005392227.1.53114 WP_005392227.1.53139 WP_005392227.1.53207 WP_005392227.1.53370 WP_005392227.1.53435 WP_005392227.1.53634 WP_005392227.1.53702 WP_005392227.1.53768 WP_005392227.1.54070 WP_005392227.1.54083 WP_005392227.1.54219 WP_005392227.1.54295 WP_005392227.1.54717 WP_005392227.1.54719 WP_005392227.1.54837 WP_005392227.1.54962 WP_005392227.1.55195 WP_005392227.1.55280 WP_005392227.1.55429 WP_005392227.1.55435 WP_005392227.1.56123 WP_005392227.1.56138 WP_005392227.1.5619 WP_005392227.1.56232 WP_005392227.1.56899 WP_005392227.1.5699 WP_005392227.1.57237 WP_005392227.1.57390 WP_005392227.1.57773 WP_005392227.1.58071 WP_005392227.1.58356 WP_005392227.1.58536 WP_005392227.1.58748 WP_005392227.1.59578 WP_005392227.1.59786 WP_005392227.1.59976 WP_005392227.1.60090 WP_005392227.1.60100 WP_005392227.1.60172 WP_005392227.1.606 WP_005392227.1.60660 WP_005392227.1.61311 WP_005392227.1.61349 WP_005392227.1.61892 WP_005392227.1.61913 WP_005392227.1.62538 WP_005392227.1.62711 WP_005392227.1.62759 WP_005392227.1.63024 WP_005392227.1.63301 WP_005392227.1.63316 WP_005392227.1.63752 WP_005392227.1.64038 WP_005392227.1.64057 WP_005392227.1.64243 WP_005392227.1.64393 WP_005392227.1.64445 WP_005392227.1.64933 WP_005392227.1.65106 WP_005392227.1.65429 WP_005392227.1.65760 WP_005392227.1.65785 WP_005392227.1.66018 WP_005392227.1.66030 WP_005392227.1.66211 WP_005392227.1.66240 WP_005392227.1.66438 WP_005392227.1.6652 WP_005392227.1.6655 WP_005392227.1.66625 WP_005392227.1.66789 WP_005392227.1.66844 WP_005392227.1.66874 WP_005392227.1.67224 WP_005392227.1.67475 WP_005392227.1.68016 WP_005392227.1.68633 WP_005392227.1.68676 WP_005392227.1.68976 WP_005392227.1.69119 WP_005392227.1.69352 WP_005392227.1.69774 WP_005392227.1.69837 WP_005392227.1.70399 WP_005392227.1.70795 WP_005392227.1.70848 WP_005392227.1.7091 WP_005392227.1.70923 WP_005392227.1.71087 WP_005392227.1.71210 WP_005392227.1.71314 WP_005392227.1.71559 WP_005392227.1.71594 WP_005392227.1.71631 WP_005392227.1.71657 WP_005392227.1.71850 WP_005392227.1.72282 WP_005392227.1.72377 WP_005392227.1.72386 WP_005392227.1.72419 WP_005392227.1.72707 WP_005392227.1.72794 WP_005392227.1.7283 WP_005392227.1.72989 WP_005392227.1.73113 WP_005392227.1.73171 WP_005392227.1.73839 WP_005392227.1.73877 WP_005392227.1.74455 WP_005392227.1.74721 WP_005392227.1.74737 WP_005392227.1.7474 WP_005392227.1.74936 WP_005392227.1.75184 WP_005392227.1.75223 WP_005392227.1.75487 WP_005392227.1.75575 WP_005392227.1.75621 WP_005392227.1.75998 WP_005392227.1.76187 WP_005392227.1.76255 WP_005392227.1.763 WP_005392227.1.76318 WP_005392227.1.76704 WP_005392227.1.76725 WP_005392227.1.76821 WP_005392227.1.76917 WP_005392227.1.77322 WP_005392227.1.77366 WP_005392227.1.77412 WP_005392227.1.77748 WP_005392227.1.78137 WP_005392227.1.78619 WP_005392227.1.78624 WP_005392227.1.78812 WP_005392227.1.78902 WP_005392227.1.78964 WP_005392227.1.79225 WP_005392227.1.79702 WP_005392227.1.7973 WP_005392227.1.7976 WP_005392227.1.80498 WP_005392227.1.8080 WP_005392227.1.81014 WP_005392227.1.81130 WP_005392227.1.81205 WP_005392227.1.81246 WP_005392227.1.81334 WP_005392227.1.81454 WP_005392227.1.81537 WP_005392227.1.81753 WP_005392227.1.81992 WP_005392227.1.81998 WP_005392227.1.82047 WP_005392227.1.8274 WP_005392227.1.82801 WP_005392227.1.82806 WP_005392227.1.830 WP_005392227.1.83069 WP_005392227.1.83207 WP_005392227.1.83328 WP_005392227.1.83411 WP_005392227.1.83659 WP_005392227.1.83742 WP_005392227.1.843 WP_005392227.1.84324 WP_005392227.1.84344 WP_005392227.1.84568 WP_005392227.1.84802 WP_005392227.1.84957 WP_005392227.1.85027 WP_005392227.1.85049 WP_005392227.1.85122 WP_005392227.1.8531 WP_005392227.1.85417 WP_005392227.1.8543 WP_005392227.1.85505 WP_005392227.1.85687 WP_005392227.1.85841 WP_005392227.1.85843 WP_005392227.1.86199 WP_005392227.1.86431 WP_005392227.1.86713 WP_005392227.1.8694 WP_005392227.1.8713 WP_005392227.1.87206 WP_005392227.1.87211 WP_005392227.1.87761 WP_005392227.1.87787 WP_005392227.1.88044 WP_005392227.1.8839 WP_005392227.1.88511 WP_005392227.1.88668 WP_005392227.1.88760 WP_005392227.1.88773 WP_005392227.1.88852 WP_005392227.1.8894 WP_005392227.1.89122 WP_005392227.1.89152 WP_005392227.1.89904 WP_005392227.1.89929 WP_005392227.1.90016 WP_005392227.1.90589 WP_005392227.1.90807 WP_005392227.1.91108 WP_005392227.1.9161 WP_005392227.1.91820 WP_005392227.1.92207 WP_005392227.1.92553 WP_005392227.1.92678 WP_005392227.1.92710 WP_005392227.1.92867 WP_005392227.1.93195 WP_005392227.1.93460 WP_005392227.1.93749 WP_005392227.1.93955 WP_005392227.1.93964 WP_005392227.1.94697 WP_005392227.1.9498 WP_005392227.1.95057 WP_005392227.1.95147 WP_005392227.1.95160 WP_005392227.1.95652 WP_005392227.1.95689 WP_005392227.1.96734 WP_005392227.1.96879 WP_005392227.1.96981 WP_005392227.1.97299 WP_005392227.1.97440 WP_005392227.1.97659 WP_005392227.1.97811 WP_005392227.1.98178 WP_005392227.1.98496 WP_005392227.1.98507 WP_005392227.1.99239 WP_005392227.1.993 WP_005392227.1.99325 WP_005392227.1.9933 WP_005392227.1.99875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]