SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433658367|ref|YP_007275746.1| from Vibrio parahaemolyticus BB22OP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433658367|ref|YP_007275746.1|
Domain Number 1 Region: 422-512
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433658367|ref|YP_007275746.1|
Sequence length 563
Comment Putative sulfate permease [Vibrio parahaemolyticus BB22OP]
Sequence
MNDFRAAFSVVAVALPVAIAYAQLTGVSAIVGLYSCVLPMLVYALMGTSRQLIVGPDAAT
CAVIAAVVTPIAAGDPTKHWQLVMTMTAMTGIWCVLASRFKLGIFADFLSRPILLGLLNG
VALTIIVGQFAKVVGLKYEQRYLLERLWEAPQRLAELHWPTVALSVATVVVYLVTKRYRP
TWPAAMLAILVTTASVWLLHLQEMDVAVVGLTQGGFPQFQAPQFELGEVRELVVPALNLA
IVSFVSMMLTARSFAAKNGYDIDANKEFQALGFANIASAFSQGFAISGADSRTAVNDANG
GKSQLVSIVAAITIAIIAVFIYEPLQFIPIASLGVVLIIASLSLLDLKAIWILKTRDKDA
FYLAIITFISVLVIGVIPGITLAVLLGLFQFLRIVMRPSDQLLGLDEKGTIRTIDETGKA
SPIPGMVIYRFNSPLTYFNAPYFKRRLLEHAEQNKDVSCVVVDAVSSFTHLDLSVMATLA
DIHEVLKKRGIRLVLAGRKRRLRQWCELTGISTSEGGILLRADMYLAIKLSGSYLSAVGE
GIVPTVQKEPDLEQPPKPIPEVA
Download sequence
Identical sequences gi|433658367|ref|YP_007275746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]