SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00016.1|PACid:22043506 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_001_00016.1|PACid:22043506
Domain Number - Region: 34-83
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000451
Family B3 DNA binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00016.1|PACid:22043506
Sequence length 105
Sequence
MKGEEEIIEVDSDKGSQHSVQEVVTGTNATDPITSSIPQFEVEMHQSYVSGLYMHIPMDL
GKCYLPSISTDITVGNMQRKEMDGAFQCRSPAELFQWWVESFCTG
Download sequence
Identical sequences A0A2G5F8C1
Aquca_001_00016.1|PACid:22043506 Aquca_001_00016.2|PACid:22043507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]