SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00025.2|PACid:22043342 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00025.2|PACid:22043342
Domain Number 1 Region: 324-555
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.56e-78
Family CAT-like 0.0000353
Further Details:      
 
Domain Number 2 Region: 126-220
Classification Level Classification E-value
Superfamily Single hybrid motif 3.8e-27
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000657
Further Details:      
 
Domain Number 3 Region: 257-301
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000000667
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00025.2|PACid:22043342
Sequence length 555
Sequence
MTYASHLLRHSKKIRNASNIRQTESTILIRWFSKETCPSAKKGNDLLKIRQCSYLPANRQ
LGSLGGCSSTSKFSFSCGARGISSLSVQGEIKGNFARTSTLFNNAFNSSQAQTVRGLSTD
SGLPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYL
AKIVQGDGAKEIKVGEVIAITVEEEEDIAKFADYKPSASDAGDGAKDTPDPTPPKEEVKE
PVRSSEPKVSKTDDAPQSGDRIFASPLARKLAEDHNVPLAKIKGTGPDGRIVKADIEDYL
ASSEKSVTPSVSKSKDTTRAETLDYTDLPHSQIRKITASRLLLSKQTIPHYYLTVDTCVD
KLMDLRKQLNSLQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDDYIRQFKNVNVNV
AVQTDNGLYVPVIRDADKKGLSKISEEVKYLAGKARENSLKPEDYEGGTFTVSNLGGPFG
IKQFCAIINPPQAGILAVGSAEKRVVPGTGANQYDFASFMSVTLSCDHRVIDGAIGAEWL
KAFKGYIENPESMLL
Download sequence
Identical sequences A0A2G5F8I3
Aquca_001_00025.1|PACid:22043341 Aquca_001_00025.2|PACid:22043342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]