SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00031.1|PACid:22043037 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00031.1|PACid:22043037
Domain Number 1 Region: 37-361
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.01e-38
Family WD40-repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00031.1|PACid:22043037
Sequence length 375
Sequence
MGCDARNWDEDAYRNSILKERELQSLTVFRTLFAPSQNPNPEIIVAASSDGSVAPYSISS
CISSYPMRFDKSRNQKSLSGFLVAEPMCLLQGHDGPAYDVKFYGDGEDSLLISCGDDGRI
QGWKWEQVLNSEMPISAQGKTLKPDLELVNPQHKGPWGALSPIPENNAIAVDSQGGSIFS
ASGDSHAYCWDVETSKIKMVFKGHSDYLHCIAARNSSNQIITGSEDGTVRIWDCKSGKCI
YMIDPEKDTKRKGSSSWISCIDLDASESWMACSSGKSLSIWNLPASECITSISTRCPTQD
LLFDQNQILAVGAEPVLTRYDMNGIALTQIQCAPQSGFSVSLHSSGVTSVGGYGGLVDVI
SQYGSHLCTFCCRGC
Download sequence
Identical sequences A0A2G5F8F5
Aquca_001_00031.1|PACid:22043037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]