SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00054.1|PACid:22043060 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00054.1|PACid:22043060
Domain Number 1 Region: 213-477
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.9e-70
Family Extended AAA-ATPase domain 0.0000000706
Further Details:      
 
Domain Number 2 Region: 463-650
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.07e-65
Family FtsH protease domain-like 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00054.1|PACid:22043060
Sequence length 706
Sequence
MAWRRILAQVSRQGLELQYIKNSIVKTRLSGNRLPIYQERFLSSYVGNLSRRVRDADGAN
SITLLKDLYRQSDPEGVIRLFESQPSLHSNSSALAEYVKALVKVDRLDESELLKTLQRGI
SKAPREENSIGSLTALRNVGRTTKDGILGTASAPIHMVTNEGGHFKEQLWRTFRSLALVF
LVISGVGALIEDRGISKGLGLNEEVQPSLDSSTKFNDVKGVDEAKGELEEIVHYLRDPKR
FTRLGGKLPKGVLLVGPPGTGKTMLARAIAGEAGVPFFSCSGSEFEEMFVGVGARRVRDL
FAAAKKRSPCIIFIDEIDAIGGSRNPKDQQYMKMTLNQLLVELDGFKQNDGIIVIAATNF
PESLDKALVRPGRFDRHIVVPNPDVEGRRQIMETHMSKVPKADDVDLMIIARGTPGFSGA
DLANLVNVAALKAAMDGAKAVSMADLEHAKDRIMMGSERKSAVISPESRKLTAFHEGGHA
LVAIHTDGALQVHKATIVPRGMALGMVSQLPDKDETSISRRQMLARLDVCMGGRVAEELI
FGESEVTSGASSDLQQATSLARAMVTKYGMSKQVGLVAHNYDDNGKSMSTETRLLIEEEV
KEFLDRAYNNAKTILTTHGKELHALANALLEHETLTGSQIKALLAQVNSQHPQKQEERKV
ESQSTSQSAPVPPSTPNATASTAAAAAAAAAAAAAAKAKGVAPVGS
Download sequence
Identical sequences A0A2G5F8P0
Aquca_001_00054.1|PACid:22043060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]