SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00082.1|PACid:22043174 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00082.1|PACid:22043174
Domain Number 1 Region: 142-347,377-443
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.53e-29
Family Phospholipase D 0.092
Further Details:      
 
Domain Number 2 Region: 461-563,609-695
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.74e-28
Family Nuclease 0.056
Further Details:      
 
Domain Number 3 Region: 7-118
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000654
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00082.1|PACid:22043174
Sequence length 766
Sequence
MERNDNKFLHGTLEVTIFHATPYTPSFPFNCLLVGEKTTYVTIKIDQKKVAKTTHAYDRI
WNQTFQILCAHSANSSITITMKRKRSVVGKFHIPANQILNETLIDGFFPLETEKGDLIPE
LKLRCILWFKHADSELSWKKVLANGDFTGLKSSSFPQRSNCHVTLYQDAHHHSTFSPPGY
PHGGPRKLWEDVYRALDGAKYLIYIAGWSFNPKMVLVRDQQTEISYARGVKIGELLKKKA
EEGVAVRVMLWDDETSLPIIKNKGVMRTHDEDALEYFKHTKVVCRLCPRLHCMFPTVFAH
HQKTITVDTSAQFLSTGEYCNSSSREIMSFIGGLDLCDGRYDTEEHSLFRTLNTQSHAQD
FYQVNFAGASLHKGGPREPWHDAHTRITGEAAWDVLSNFEQRWSKQCDPCLLVSTSTITN
LRRSYTQHEDPPAGNWKVQVFRSIDHLSVKSSLPNKSSVECSIHEAYIEAIRRADRFIYI
ENQYFIGGCHMWENDKHCGCKNLIPVEIALKIVSKIKAKERFAVYVVIPMWPEGLPNSDP
VQDMLHWTRQTMGMMYKLIGEAIQESSEPVHPRDYLNFFCLANREQETKGEFIPPYSPQH
ASQYWNAQNHRRFMVYVHSKLMIVDDIYTLIGSANVNQRSMDGRRDTEIAIGCYQPKYVD
KKSGCGDVHAYRMSLWYEHTGRSEELFQDPHSLACVRMLRTIGEESWNVYSGEEVRDMEG
VHLVNYPVTVLNDGTVEDLAEGGGTFPDTRTPVRGKRSILPPSFTT
Download sequence
Identical sequences A0A2G5F8Q7
Aquca_001_00082.1|PACid:22043174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]