SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00341.1|PACid:22043501 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00341.1|PACid:22043501
Domain Number 1 Region: 83-170
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.6e-16
Family 2Fe-2S ferredoxin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00341.1|PACid:22043501
Sequence length 185
Sequence
MGLLLHLNSHVTLPSTFNYISSKSYTPFKFPTNLSFSRRNKIRAVGTVSGSESEIKSSDE
EPPSIDFAFVHSVLLPDGTPDVHIRSACGGQKLRDIMLDSNIDLYGPYGRPLLNCAGGGT
CGTCMVEVVEGKELLNYRTDKEKEILKRKPKTWRLACQTIVGKPDSRGEVVIQQLPEWKA
HEWTK
Download sequence
Identical sequences A0A2G5F9V4
Aquca_001_00341.1|PACid:22043501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]