SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00349.1|PACid:22042988 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00349.1|PACid:22042988
Domain Number 1 Region: 313-421
Classification Level Classification E-value
Superfamily PH domain-like 0.00000516
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00349.1|PACid:22042988
Sequence length 429
Sequence
MESFVCRPKCSSGRLEDIEEDRPAILAPLGLGCVPPETPTESMEFLARSWSLSALELSKA
LAETHLHSNVPDNVPFCPPGTETHDILSTTTACSAESIAMETKSSEKFQHLPPLESSAEN
PPMESDEAKELYLLHQALNPAFQSHQHLLNNGLYKSVLRGKTMGRWLKDQREKKKQEIRT
HKAQLHAAMSVAGVAAAVAVIAAATATSSAAQYDEPSKISAALASAAALVASQCVEIADE
MGADHDHILEIVNSAVNVRTAGDIMTLTAGAATALRGVATLKARLQRGCRTAILSPTEER
AEEGKELDMSAELYFVLKGGELLKRTRKGSLHWKQVSFHMNSHWQVVAKMKSRHIVGTFT
KKKKCLVLGVSCDIPLWPGRDSEGDVEQRGYFGIKTADRLIQFECKSKLEKQMWTDGIKQ
MLHRHANMI
Download sequence
Identical sequences A0A2G5F9Y8
Aquca_001_00349.1|PACid:22042988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]