SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00353.1|PACid:22043263 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00353.1|PACid:22043263
Domain Number 1 Region: 82-416
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.55e-48
Family WD40-repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00353.1|PACid:22043263
Sequence length 435
Sequence
RKRKEESMASKDPNNSPPHYTFNVNRLFRSISTKESSNPPPFSPPRNSTSSFTLPYKPSP
PPSPSPSSTFPNPEKFLPNPEKCQPSHRCISSMLKKDGRILSIAVSNGLVYTGSETNCIR
IWKLPEFTECGKLKSKVGMVYALAVSNDRVFAAYSDCKIRVWRRTWDGIPTHVRIATIPK
LGNYVRNYIAGKDKKMMKHIGPISSLAINVSDDLLYSASTDKTVKVWKMSDLKCIETIQA
HSEPVNAVVVGDDGVLYTASDDATVRVWRRNFCNGDRPHSLTITLPAKQSPVKALALTAD
SGFLYGGCTDGYIHYWLKGWFSGQLQYGGALQGHTHAIMCLTTVANYMVSGSADLTCRVW
VREKDSQHSCLAVLQGHRGPVRCVSAFTERVLGESEDGCTVCTGSLDGILKVWRVSHSCE
SSRSSPQGGKEYFEL
Download sequence
Identical sequences A0A2G5FA34
Aquca_001_00353.1|PACid:22043263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]