SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00511.1|PACid:22043914 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00511.1|PACid:22043914
Domain Number 1 Region: 68-201
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.79e-52
Family C-terminal domain of ribosomal protein L2 0.00000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00511.1|PACid:22043914
Sequence length 227
Sequence
MLIGKFFIRRSTQIRNFCSKSTTRVAARSLIPAPHNLSVGNYILNSNGGKGVNRYEAKTE
MLDLNSQIGNCIPLSNIRIGTWVHCIELQPGQGAKLVRAAGTFAKVLKESAISGGRHCLL
RLPSGSEKLVDSKCKATVGQVSNLSHGARKLRKAGHSRWLGRRPVVRGVAMNPVDHPHGG
GEGRTKGGRPSVSPWGKPTKAGYKSEAVKAKQAKLGTRPVKAKQGRK
Download sequence
Identical sequences A0A2G5FAP7
Aquca_001_00511.1|PACid:22043914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]