SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00524.2|PACid:22043727 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00524.2|PACid:22043727
Domain Number 1 Region: 549-773
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.75e-34
Family DNA repair protein MutS, domain III 0.00078
Further Details:      
 
Domain Number 2 Region: 251-372
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.1e-29
Family DNA repair protein MutS, domain I 0.0007
Further Details:      
 
Domain Number 3 Region: 799-942
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.63e-29
Family ABC transporter ATPase domain-like 0.0000579
Further Details:      
 
Domain Number 4 Region: 400-446,478-561
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000000127
Family DNA repair protein MutS, domain II 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00524.2|PACid:22043727
Sequence length 955
Sequence
MKRQQSILSFFQKPLPGKQNISNEDDVLHGNRFPQAPAKRDSDTSTVPTAKDILPEVTGT
DTPPEKLPRQVLPAKFSANGNTSRPTMFSSIMHKFAKVADVDISPARNKAENGSTSSCST
SNVFGAGSRIFKSETPSQNPLKDKGFEINSCGEGNPLQIENDVEMLGPETPVMQPAVSRL
KRIQVDCNDFDKNNCSLLNSSKRLKLAEDSEKQSCAEVSEIANSKFEWLNPSSIRDADRR
RPGDPLYDRRTLYIPPDVLKKMSACQKQYWSVKCQYMDVVIFFKVGKFYELYELDAEIGH
KELDWKMTFSGVGKCRQVGISENGIEEAVQKLIARGYKVGRMEQMETSDQAKARGAGSVI
QRKLVHVVTPSTIANDNIGPDAVHLLTLKEGSCKLDNGSTVYGFAFVDCAALRFWIGSIS
DDASCAALGALLLQVSPKEVIYESRGLSREAQRALKKYSSTGHTTLTPALSVTDFLDFSG
VKELIDSKRYFKGSFYTLDTVSAGVMHHELAVCALGGLVNHLSRLMLDDVLCNGDILPYL
VYRGCLRLDGQSLLNLEIFSNNVDGGTAGTLYKYLDNCVTYSGKRLLRTWICHPLKDVGE
INDRLNVVEGFIAHPELSFTVAQYLRKIPDIERLLGRLKASVGSSALLLLPLIGEKALKQ
RVKTYGTLVKGLRVGIDLLKLLHEKEHEISSLSNILNVPLQSGNSGLDDLLNQFEATVDS
DFPKYQDHVVSSSDAETLSVLIELLAENATRWSQVIHALNCVDVLRSFAVTASSSSGFMC
RPALPISDSRSKNSCEENEGPVLKFKGLWHPYAALGASWETIVPNDLYLGADPTGNCPRT
LLLTGPNMGGKSTLLRATCLAVILAQLGCYVPCETCVLSPVDIIFTRLGATDRIMTGEST
FLIECTETASVLQNATHDSLVILDELGRGTSTFDGYAIAYAVSIAIYLPWFMDLL
Download sequence
Identical sequences A0A2G5FB15
Aquca_001_00524.2|PACid:22043727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]