SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00524.3|PACid:22043728 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00524.3|PACid:22043728
Domain Number 1 Region: 549-773
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-34
Family DNA repair protein MutS, domain III 0.00078
Further Details:      
 
Domain Number 2 Region: 251-372
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 9.68e-30
Family DNA repair protein MutS, domain I 0.0007
Further Details:      
 
Domain Number 3 Region: 799-868
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000111
Family ABC transporter ATPase domain-like 0.0081
Further Details:      
 
Domain Number 4 Region: 400-446,478-561
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.00000011
Family DNA repair protein MutS, domain II 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00524.3|PACid:22043728
Sequence length 871
Sequence
MKRQQSILSFFQKPLPGKQNISNEDDVLHGNRFPQAPAKRDSDTSTVPTAKDILPEVTGT
DTPPEKLPRQVLPAKFSANGNTSRPTMFSSIMHKFAKVADVDISPARNKAENGSTSSCST
SNVFGAGSRIFKSETPSQNPLKDKGFEINSCGEGNPLQIENDVEMLGPETPVMQPAVSRL
KRIQVDCNDFDKNNCSLLNSSKRLKLAEDSEKQSCAEVSEIANSKFEWLNPSSIRDADRR
RPGDPLYDRRTLYIPPDVLKKMSACQKQYWSVKCQYMDVVIFFKVGKFYELYELDAEIGH
KELDWKMTFSGVGKCRQVGISENGIEEAVQKLIARGYKVGRMEQMETSDQAKARGAGSVI
QRKLVHVVTPSTIANDNIGPDAVHLLTLKEGSCKLDNGSTVYGFAFVDCAALRFWIGSIS
DDASCAALGALLLQVSPKEVIYESRGLSREAQRALKKYSSTGHTTLTPALSVTDFLDFSG
VKELIDSKRYFKGSFYTLDTVSAGVMHHELAVCALGGLVNHLSRLMLDDVLCNGDILPYL
VYRGCLRLDGQSLLNLEIFSNNVDGGTAGTLYKYLDNCVTYSGKRLLRTWICHPLKDVGE
INDRLNVVEGFIAHPELSFTVAQYLRKIPDIERLLGRLKASVGSSALLLLPLIGEKALKQ
RVKTYGTLVKGLRVGIDLLKLLHEKEHEISSLSNILNVPLQSGNSGLDDLLNQFEATVDS
DFPKYQDHVVSSSDAETLSVLIELLAENATRWSQVIHALNCVDVLRSFAVTASSSSGFMC
RPALPISDSRSKNSCEENEGPVLKFKGLWHPYAALGASWETIVPNDLYLGADPTGNCPRT
LLLTGPNMGGKSTLLRATCLAVILAQVCYVV
Download sequence
Identical sequences A0A2G5FAV7
Aquca_001_00524.3|PACid:22043728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]