SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00557.1|PACid:22043570 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00557.1|PACid:22043570
Domain Number 1 Region: 467-695
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000366
Family Tropomyosin 0.0037
Further Details:      
 
Weak hits

Sequence:  Aquca_001_00557.1|PACid:22043570
Domain Number - Region: 384-490
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00204
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 147-299
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00557.1|PACid:22043570
Sequence length 800
Sequence
MGFAMGSSCFLQTPLSQHLCLTSSSQSFLLTSFRFKNTKNFKKQRSLVIASSSSSSNLHG
ITNESDFCKRRAIVVLGISALPFLQVKARADAETLVEEERDLRALEENQSAEQLHQGEVQ
INPLLSLLNVVGVIGSGVLGALYTLAQKEKTTTETTIESLKNRLVEKDAAMVTLEKNFER
KILNEQEERDRINNQAKEERHSMSNQLTTANGTIDGLRKELTNEKRLIEELKIHIAKLQN
DLVKSGEDNKMLEEKLKEKLDSIEVLNDRINLLTLEIKDKEDNLQNLNSTLNEKESECDN
LIFMNKRSKQDLTEASSEIKSLKGELFKTREDLNLKNSTIDDLKSRIILLTAERDDVNRE
LKTIQEDYKDLKSSSEKKAATDAEILRKMEHELHQFEEKLRLALNEASNNQRAIADLTKE
RDSLRTLLEVEVDNVKKLQHELWSKDETLQTSIKEVSDLSEQLRKSKRTCEELASAFSTV
KNEFAENQEMLMSSLEEARSESEVLSAELVSVKNDFEKTKEESQILSNELARVTETRENL
KKELLDVYKIAESASHDLKEERNMLATLQKQLEASEKQIQEDKKARKSLETDLEDATKSL
DEVNKNVLMLSRELDTANSRVESLEVEKDVLYKSLTEQKNLSKEAKENIEEAHDIIMKLG
KERENLDNRVKKLEEELASAKGEIIRLRSQKSSSKIRVNDVPKKKIAEVENDTAVTGKKV
ESDAAVTGKKVDSDAAVTGKKVDSDAAVTGKKVDSDAAVTGKEVEADVPVTEKKNSDYAV
TMKRVGQRRKSSGRKSKASQ
Download sequence
Identical sequences A0A2G5FB24
Aquca_001_00557.1|PACid:22043570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]