SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00557.4|PACid:22043573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00557.4|PACid:22043573
Domain Number 1 Region: 296-525
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000177
Family Tropomyosin 0.0037
Further Details:      
 
Weak hits

Sequence:  Aquca_001_00557.4|PACid:22043573
Domain Number - Region: 214-320
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00126
Family Myosin rod fragments 0.0091
Further Details:      
 
Domain Number - Region: 31-272
Classification Level Classification E-value
Superfamily Tropomyosin 0.00386
Family Tropomyosin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00557.4|PACid:22043573
Sequence length 630
Sequence
MVTLEKNFERKILNEQEERDRINNQAKEERHSMSNQLTTANGTIDGLRKELTNEKRLIEE
LKIHIAKLQNDLVKSGEDNKMLEEKLKEKLDSIEVLNDRINLLTLEIKDKEDNLQNLNST
LNEKESECDNLIFMNKRSKQDLTEASSEIKSLKGELFKTREDLNLKNSTIDDLKSRIILL
TAERDDVNRELKTIQEDYKDLKSSSEKKAATDAEILRKMEHELHQFEEKLRLALNEASNN
QRAIADLTKERDSLRTLLEVEVDNVKKLQHELWSKDETLQTSIKEVSDLSEQLRKSKRTC
EELASAFSTVKNEFAENQEMLMSSLEEARSESEVLSAELVSVKNDFEKTKEESQILSNEL
ARVTETRENLKKELLDVYKIAESASHDLKEERNMLATLQKQLEASEKQIQEDKKARKSLE
TDLEDATKSLDEVNKNVLMLSRELDTANSRVESLEVEKDVLYKSLTEQKNLSKEAKENIE
EAHDIIMKLGKERENLDNRVKKLEEELASAKGEIIRLRSQKSSSKIRVNDVPKKKIAEVE
NDTAVTGKKVESDAAVTGKKVDSDAAVTGKKVDSDAAVTGKKVDSDAAVTGKEVEADVPV
TEKKNSDYAVTMKRVGQRRKSSGRKSKASQ
Download sequence
Identical sequences A0A2G5FB66
Aquca_001_00557.3|PACid:22043572 Aquca_001_00557.4|PACid:22043573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]