SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00570.15|PACid:22043892 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00570.15|PACid:22043892
Domain Number 1 Region: 3-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-78
Family WD40-repeat 0.0000481
Further Details:      
 
Domain Number 2 Region: 221-319,350-491
Classification Level Classification E-value
Superfamily NHL repeat 1.33e-19
Family NHL repeat 0.024
Further Details:      
 
Weak hits

Sequence:  Aquca_001_00570.15|PACid:22043892
Domain Number - Region: 657-730,786-835
Classification Level Classification E-value
Superfamily TPR-like 0.0417
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00570.15|PACid:22043892
Sequence length 894
Sequence
MPLRLEIKRKLAQRSERVKSTDLHPTEPWILVSLYSGSICIWNYQSQTMAKSFEATELPV
RSSKFIARKQWVVAGSDDMHIRVFNYNTMDKVKVFEAHTDYIRCVAVHPTLPYVLSSSDD
MLIKLWDWEKGWMCTQIFEGHSHYVMQVTFNPKDSNTFASASLDRTIKIWNLGSPDPNFT
LDAHSKGVNCVDYYTGGDRPFLITGSDDHTAKVWDYQTRTCVQTLEGHTHNISAVCFHPE
LPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWALGYLKGSRRIVIGYDEGTIMIKIG
REEPVASMDSSGKIIWAKNNEVQTVNIKSVGADFEVTDGERLPLAVKELGSCDLYPQSLK
HNPNGRFVVVCGDGEYIIYTALAWRNRSFGSALEFVWSSDGEYAARESTSRIKLFSKNFQ
EKKSIRPTFSTERIFGGILLAMCSNEFICFYDWTECRLIRRIDVNVKNLYWADSGDMVVI
ASDTSFFILKYNRDIVSSYWDSGKPVEEEGVEDSFELLHEINERVRTGVWVGDCFIYNNS
SWRLNYCVGGEVTTMFHLDRPMYLLGYLANQSRVYLIDKGFNVIGYTLLLSLIEYKTLVM
RGDLERASEILPSIPKEHHDSVAHFLESRGMLEDALEVATDSNYRFDLAIQLGKLEIAKA
IASEAQSESKWKQLGQLAMSNGKFEMAEECLRHGMDFSGLLLLYSSIGDAEGITHLASLA
KEKGKNNVAFLSLFMLGKLEECIQLLVESNRIPEAVLMARSYLPSKVSEMVAIWKKDLNK
VNQKAAESLADPEEYPNLFEDWQVALAVESQILETRGTYPPAEQYLNFADRLNVNLVEDF
KKLQIEQEEAPLENGDLAPEVEENGEAESQEEAVEVDVDSTDGVVLVNVFAPRY
Download sequence
Identical sequences A0A2G5FB31
Aquca_001_00570.15|PACid:22043892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]