SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00601.2|PACid:22044269 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_001_00601.2|PACid:22044269
Domain Number - Region: 26-75
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000149
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00601.2|PACid:22044269
Sequence length 238
Sequence
MAELKLKQKGDNPSPSIVRMKRNKFFRVIKSRYPQIEFPSEFVEEHGYKLPDELVLKVRT
GDFWNIKVKKFGERIRTLRDAEIDYPLKPHKFKNTIHGGAKLGESTNKECVKNSTKNLGM
TSPREDTHQRTEHGEPSVYRANEDMAPEDVPAPKQVSCDTPAVSPSQTNADGVGQRTGSF
NSKYPFFKITMGRSYINQASVVSSLSERLYVEHNTHTVYAYVSEICFAFCSLYQSHLL
Download sequence
Identical sequences A0A2G5FB53
Aquca_001_00601.2|PACid:22044269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]