SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00636.2|PACid:22043252 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00636.2|PACid:22043252
Domain Number 1 Region: 111-191
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000249
Family 2Fe-2S ferredoxin-related 0.031
Further Details:      
 
Weak hits

Sequence:  Aquca_001_00636.2|PACid:22043252
Domain Number - Region: 56-82
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0157
Family Obg GTP-binding protein N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00636.2|PACid:22043252
Sequence length 202
Sequence
MACKFQLVSLSHGNGMQSLSSRNEKSNNSLYSYTTRPPKYYSILSTTTTKNKPIIYNNIG
AGGGGGGGGGGGVVLAASSTITESTPSIPEKPQIELDFIGPKVGADGSYPVEKASAISGD
KLLRNIMLDNKIELYATYGKVMNCGGGGSCGTCIVEIIDGKDLLNERTNTELRYLKKKPE
SWRLACQTIVGNKENSGKVWCM
Download sequence
Identical sequences A0A2G5FBC5
Aquca_001_00636.2|PACid:22043252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]