SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00792.1|PACid:22043121 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00792.1|PACid:22043121
Domain Number 1 Region: 128-221,335-592
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.59e-68
Family WD40-repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 8-196
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 4.9e-22
Family DPP6 N-terminal domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 555-664,722-760
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000000000000745
Family Tricorn protease domain 2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00792.1|PACid:22043121
Sequence length 899
Sequence
MNYRFQNLLGAPYRGGNAIISDNSNLITPIGNRISVTDLIKSETKTLPCESSSNISRIAV
SPDGTFLITIDDKSRCHFINLRRHVVLHRMTMKKPVSAIKFSPDGGLIAFGVGKLVQIWR
SPGFRKEFFPFQLIRTFADCDETVTALDWSPDSNYLLVGSKDLTVRLLCLKKIRGGYKPF
LFLGHRESIVGVFFGIDNKSGKVCRVYTISRNCYIFTWNYIESEDSNNNTEDLQGQISDP
PSPGTPEKNPSGVSTEIVVSGAYGNVRKRKEFDDTGDNAEGEIEFPLHKGKWELLKKDHF
GQTPARLTACDYHRGLDLVVVGFSNGVFGLYQMPDFICLHSLSISREKITTACFNDLGNW
LTLGCARLGQLLVWEWRSESYILKQQGHYFDVNCVAYSPDSQLLATGADDNKIKVWTVSS
GFCFVTFSEHTNAVTALHFMTGNNCLLSASMDGTVRAWDLFRYRNFRTFTSPQSRQFVSL
ASDQSGEVICAGTLDSFEIFVWSMKTGRLLDILSGHEGPVHGLMFSPTTAILASSSWDKT
VRLWDVFEGKGAVETFPHTHDVLTVVYRPDGKQLACSTLDGQIHFWDPLDGVLMHTIEGR
RDIAGGRLMTDRRSAANSSSGKFFTSLCYSADGSYILAGGSSKYICMYCVADQVLLRRFQ
VTHNLSLDGVLDFLNSKKMTEAGPLELIDDNSDVEEGINRQTRGKLGYDLPGSMPNQGRP
IIRTKCLRIAPTGRSWAAATTEGVLIYSIDESFVFDPTDLDMDVTPEAVDAALSEDQPKR
ALLLSLRLNEDSLIKKCIITVKPVDIPAVASSIPLRYLRRLIEALANLLENSPHLEFILS
WCQELSKAHGHSIQQNSRSLLPALRSLQKAITRLHQDLADTCSSNEYMLRYLCSTGTKS
Download sequence
Identical sequences A0A2G5FC75
Aquca_001_00792.1|PACid:22043121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]