SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_001_00872.2|PACid:22043110 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_001_00872.2|PACid:22043110
Domain Number 1 Region: 97-299
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.5e-44
Family Pseudouridine synthase RsuA/RluD 0.00026
Further Details:      
 
Weak hits

Sequence:  Aquca_001_00872.2|PACid:22043110
Domain Number - Region: 57-86
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00141
Family Pseudouridine synthase RsuA N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_001_00872.2|PACid:22043110
Sequence length 318
Sequence
MGSAEGSGIGGKQFGVAWPDFNDGLTYTDNVQDSSISLIEFYSTNHNNSAPLQGWLQRIQ
NGQITVDGQVVKDPQTILRSGSQLVYHRLPWKEPDAPYLLQVLFEDDHLVAVNKPSGLQV
LPGGLFQQRTVLTQLQWRVAADYGQPQPSPVHRLGRGTSGILLCAKTKLAKVCLASYFAH
GTSIVGDKRTISLEVNATRKISKIYRALVTGIIKEHQVVIEQPIGMIRYPGVAHGLYVAS
SSGKPAMSRVNVLERNIQANQSLVQVEIQSGRPHQIRIHLSFIGHPLVGDPLYATGGRPV
CFDSESGAEDCGQDGYDI
Download sequence
Identical sequences A0A2G5FCB4
Aquca_001_00872.2|PACid:22043110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]