SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00096.1|PACid:22053029 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00096.1|PACid:22053029
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 1.57e-16
Family Ribosomal protein L29 (L29p) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00096.1|PACid:22053029
Sequence length 128
Sequence
MFGFFVARIKVHELRDKSKTDLLSQLNELKAELALLRVAKVTGGAPNKLSKIKVVRLSIA
RVLTVISQTQKAALRNAYKNKKLLPLDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYFP
MRKYAIKV
Download sequence
Identical sequences A0A2G5F1L5
Aquca_002_00096.1|PACid:22053029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]