SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00120.4|PACid:22053156 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00120.4|PACid:22053156
Domain Number 1 Region: 189-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.4e-73
Family Tandem AAA-ATPase domain 0.00000972
Further Details:      
 
Domain Number 2 Region: 7-48
Classification Level Classification E-value
Superfamily WW domain 0.00000000652
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00120.4|PACid:22053156
Sequence length 447
Sequence
MTAASVRYAPEDPTLPKPWKGLVDGNTGYLYFWNPVTNVTQYEKPTAPSDAPAPAPTPTP
TKSVASVVSSPVREEKPSQEKQALDTNNDNGVGHDGGSKVAATDERKADDWSKVGATDER
KADAWSKVASADQRSAQQSVGNGGAHLSEASAKVTHSDIPKNDYEAQTVNSSAQPLVTNV
DGPSADAYRRQNEITVIGDNVPPPFTSFESTGFPPEVLRVVRGAGFKAPTPIQAQSWPIA
LRSHDIVAVAKTGSGKTLGYLLPGFMHIKRTGKNPKMGPTVLVLSPTRELATQIQDEAEK
FGQSSKISCTCLYGGAQKGPQIRDLEQGVHIVVATPGRLNDIMEMGKISLNQVSYLVLDE
ADRMLDMGFEPQIRKILKEIPTRRQTLMYTATWPKGVRNIASEFLNKPVQVNIGRTDQLV
ANKSIAQVLKGKAFVSLSLLVLYISYN
Download sequence
Identical sequences A0A2G5F1Y7
Aquca_002_00120.4|PACid:22053156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]