SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_002_00222.2|PACid:22051658 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_002_00222.2|PACid:22051658
Domain Number 1 Region: 116-190
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-24
Family Skp1 dimerisation domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 45-106
Classification Level Classification E-value
Superfamily POZ domain 1.81e-20
Family BTB/POZ domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_002_00222.2|PACid:22051658
Sequence length 193
Sequence
MNPNGVASSSKVEEGLNNLSLETSSKAKEEKQQHVECSSSEPKKLLKLKTSDGEVFEVEE
AIMLQSETIKHMIEDGCADDEIPLLNISGNILKIVIEYCKKHVGDELLNIYEKEELKQWD
WKFIEIERIPLFYVLIAANFLGIKGLLDLGCKQVGKMMKGKNCEQVREMFGIVNDFTPEE
EAELRNKNKWRSE
Download sequence
Identical sequences A0A2G5F288
Aquca_002_00222.1|PACid:22051657 Aquca_002_00222.2|PACid:22051658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]